KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os12t0183300-01
Entry
Os12t0183300-01   CDS       T02163                                 

Gene name
Os12g0183300
Definition
(RAP-DB) Similar to 3'(2'),5'-bisphosphate nucleotidase.
  KO
K15422  3'(2'), 5'-bisphosphate nucleotidase / inositol polyphosphate 1-phosphatase [EC:3.1.3.7 3.1.3.57]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa00562  Inositol phosphate metabolism
dosa00920  Sulfur metabolism
dosa01100  Metabolic pathways
dosa04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Os12t0183300-01 (Os12g0183300)
  09102 Energy metabolism
   00920 Sulfur metabolism
    Os12t0183300-01 (Os12g0183300)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    Os12t0183300-01 (Os12g0183300)
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Os12t0183300-01 (Os12g0183300)
    3.1.3.57  inositol-1,4-bisphosphate 1-phosphatase
     Os12t0183300-01 (Os12g0183300)
SSDB
Motif
Pfam: Inositol_P
Other DBs
RAP-DB: Os12t0183300-01
Position
chr12:complement(join(4217592..4217768,4217392..4217490,4217161..4217314,4216826..4216998))
AA seq 200 aa
ALLDEGKVVLGVLACPNLSLGSIGNLNGGSSGDQVGALFSATIGCGAEVESLQGSPAQKI
SVCSIDNPVEASFFESYEGAHSLRDLTGSIAEKLGVQAPPVRIDSQAKYGALARGDGAIY
LRFPHKGYREKIWDHAAGSIVVTEAGGLVTDASGNDLDFSKGRFLDLDTGIIATNKQLMP
SLLKAVQDAIKEQNQAASPL
NT seq 603 nt   +upstreamnt  +downstreamnt
gctctgcttgatgagggtaaagttgttttgggtgtattggcttgtcccaacctttctttg
ggatcaataggcaaccttaatggtggctcctcgggagatcaagttggtgctctcttttct
gctactattggttgtggagctgaagtagagtctttacagggctctccagcacaaaagatt
agtgtctgttccatcgacaatccagtcgaagcttcattctttgagtcctacgaaggggca
cactccttgcgtgatttaacaggctccattgcggagaaacttggtgtccaagctcctcca
gttagaattgatagccaagcaaaatacggtgccctagcccgaggtgacggtgccatttac
ttgcgttttccacacaaaggttacagagagaagatctgggatcatgcagctgggtcaatc
gtcgtgacagaagctggaggtctggtgacagatgcatcaggaaacgatttggatttctcc
aaagggagatttcttgatctcgacacagggatcatcgcgacgaacaagcagctgatgcct
tcactcctgaaggctgtgcaagatgccatcaaggagcaaaaccaggctgcttccccgttg
tag

DBGET integrated database retrieval system