KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os12t0210300-01Help
Entry
Os12t0210300-01   CDS       T02163                                 

Gene name
Os12g0210300, ZETA_GLUTATHIONE_S-TRANSFERASE_2, GSTZ2
Definition
(RAP-DB) Similar to Glutathione S-transferase GST 18 (EC 2.5.1.18).
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa00350  Tyrosine metabolism
dosa01100  Metabolic pathways
Module
dosa_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    Os12t0210300-01 (Os12g0210300)
Enzymes [BR:dosa01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     Os12t0210300-01 (Os12g0210300)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 GST_C_3 GST_C
Motif
Other DBs
RAP-DB: Os12t0210300-01
Position
chr12:join(5760642..5760723,5761248..5761292,5761691..5761776,5761889..5761960,5762211..5762264,5762386..5762461,5762779..5762840,5763175..5763234,5763332..5763433)
AA seq 212 aa AA seqDB search
MASSKPILYGAWISSCSHRIRIVLNLKGVDYEYKSVNPRTDPDYEKINPIKYIPALVDGD
LVVSDSLAIALYLEDKYPQHALLPKDLKKKALNLQIANIVCSSIQPLQGYAVIGLHEGKL
SPDESLQIVQHYIDKGFKAIEKLLEGSNFKYATGDEVQLGDVFLAPQIHAGINRFQIDIT
KYPNLARLHDTYMEIPAFQAALPKNQPDAPSC
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgtcaaagccaatcctgtacggtgcctggatcagctcctgctctcaccgaatc
cggatcgttctcaatctcaaaggtgtggattatgagtacaagtcagtcaatcctcgaaca
gatccagactatgagaaaatcaatccaattaagtacataccagcattagtagatggagac
ctagttgtttctgactctctcgccattgcattgtatcttgaagataaataccctcaacat
gctctcctacctaaggatctcaaaaagaaagctcttaatcttcagattgcaaacatagtt
tgttcaagcatccaacctctccaaggttatgctgtaattggtttgcatgagggtaagcta
agccccgatgagagtcttcagatagttcagcattatattgataagggcttcaaagcaatc
gaaaagcttttagaaggatccaactttaaatatgctactggggacgaagttcaattgggg
gatgtgtttctagcaccacagatccatgctggcataaatcgcttccaaattgatatcaca
aagtacccaaatttggcaagactccatgacacatacatggaaattcctgcatttcaggca
gcacttccaaagaatcagccagatgcaccttcatgctaa

DBGET integrated database retrieval system