KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os12t0247700-01
Entry
Os12t0247700-01   CDS       T02163                                 

Gene name
Os12g0247700
Definition
(RAP-DB) Similar to Jasmonate-induced protein.
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
SSDB
Motif
Pfam: Jacalin Dirigent
Other DBs
RAP-DB: Os12t0247700-01
Position
chr12:join(8239504..8239793,8240098..8240287,8240389..8240589,8240698..8240937)
AA seq 306 aa
MADPSKLQITPCGMLVQGNQINFTKLYLHHTPAGPEQNQSAVTSNDKKTGLGCIVVNNWS
VYDGIGSDAKLVAYAKGLHVFAGAWHNSFSLVFEDERLKGSTLQVMGLIVEEGDWAIVGG
TGQFAMATGVILKKMQEQKQYGNIIELTIHGFCPLLKGSQCPVTKIGPWGSSHEGTVQDI
TESPKRLESITLYHGWSVDSISFTYLDHAGEKHKAGPWGGPGGDPIMIEFGSSEFLKEVS
GTFGPYEGSTVITSINFITNKQTYGPFGRQEGTPFSVPAQNNSSIVGFFGRSGKYINAVG
VYVQPI
NT seq 921 nt   +upstreamnt  +downstreamnt
atggctgatcccagcaagctgcaaatcacaccctgtggcatgcttgttcagggcaaccag
atcaacttcaccaaactctacctgcaccacacgccggctggtccagaacaaaaccagtcg
gcggtcacaagcaatgacaaaaaaaccgggttgggttgcattgtcgttaacaactggtca
gtatatgacggaatcggcagcgacgccaagcttgttgcctatgcaaaaggcctccacgtt
tttgcgggtgcctggcacaactccttcagcctagtgttcgaggatgaaaggcttaagggg
tccacgcttcaggtgatggggctaattgtcgaagaaggtgattgggctattgttgggggc
acaggacagtttgctatggcaactggtgttatcttgaagaaaatgcaagaacaaaaacaa
tacggaaacataatagagctcactatccatgggttttgtcctctcttaaaagggtcacag
tgccctgtcaccaagattgggccatggggttcatctcatgaagggacagttcaagacatc
actgagtctccaaagcgtctcgaaagcatcacattataccacggctggtctgttgactca
atctcgtttacttaccttgaccatgccggagagaagcacaaggcaggtccatggggtggt
cctggcggggatcccataatgattgaatttggcagttcagagtttctcaaggaagtttct
ggaacgtttggcccatatgagggcagcaccgttataacatctattaattttatcaccaat
aagcaaacatatggcccatttggacgacaggagggaacccctttcagtgtcccagcgcag
aataactccagtatagtgggtttctttgggcgcagtgggaaatacataaatgcagttggt
gtctacgtgcagccgatctaa

DBGET integrated database retrieval system