KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os12t0268000-01
Entry
Os12t0268000-01   CDS       T02163                                 

Gene name
Os12g0268000
Definition
(RAP-DB) Similar to Cytochrome P450 71A1 (EC 1.14.-.-) (CYPLXXIA1) (ARP-2).
  KO
K20617  cytochrome P450 family 71 subfamily A
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:dosa00199]
    Os12t0268000-01 (Os12g0268000)
Cytochrome P450 [BR:dosa00199]
 Cytochrome P450, plant type
  CYP71 family
   Os12t0268000-01 (Os12g0268000)
SSDB
Motif
Pfam: p450
Other DBs
RAP-DB: Os12t0268000-01
Position
chr12:complement(join(9580787..9581701,9580034..9580690))
AA seq 523 aa
MELTMASTMSLALLVLSAAYVLVALRRSRSSSSKPRRLPPSPPGWPVIGHLHLMSGMPHH
ALAELARTMRAPLFRMRLGSVPAVVISKPDLARAALTTNDAALASRPHLLSGQFLSFGCS
DVTFAPAGPYHRMARRVVVSELLSARRVATYGAVRVKELRRLLAHLTKNTSPAKPVDLSE
CFLNLANDVLCRVAFGRRFPHGEGDKLGAVLAEAQDLFAGFTIGDFFPELEPVASTVTGL
RRRLKKCLADLREACDVIVDEHISGNRQRIPGDRDEDFVDVLLRVQKSPDLEVPLTDDNL
KALVLDMFVAGTDTTFATLEWVMTELVRHPRILKKAQEEVRRVVGDSGRVEESHLGELHY
MRAIIKETFRLHPAVPLLVPRESVAPCTLGGYDIPARTRVFINTFAMGRDPEIWDNPLEY
SPERFESAGGGGEIDLKDPDYKLLPFGGGRRGCPGYTFALATVQVSLASLLYHFEWALPA
GVRAEDVNLDETFGLATRKKEPLFVAVRKSDAYEFKGEELSEV
NT seq 1572 nt   +upstreamnt  +downstreamnt
atggagctcaccatggcgtcgacgatgtcgctcgcgctgctcgtgctctccgcggcgtac
gtgttggtcgcgttgaggaggagccggtcgtcgtcgtcaaagccacggcggctgccgccg
tcgccgccggggtggccggtgatcgggcacctccacctcatgtccggcatgccgcaccac
gcgctggccgagctggcgcgcaccatgcgcgcgccgctgttccggatgcggctggggagc
gtgccggcggtggtgatctccaagccggacctcgcccgcgccgcgctcaccaccaacgac
gccgcgctggcgtcgcggccgcacctgctctccggccagttcctgtcgttcggctgctcc
gacgtgacgttcgcgccggcggggccgtaccaccggatggcgcgccgcgtggtggtgtcg
gagctcctgtcggcgcgtcgcgtcgccacgtacggcgccgtcagggtcaaggagctccgc
cgcctgctcgcgcacctcaccaagaacacctcgccggcgaagcccgtcgacctcagcgag
tgcttcctcaacctcgccaacgacgtgctctgccgcgtcgcgttcggccgccggttcccg
cacggcgagggcgacaagctcggcgcggtgctcgccgaggcgcaggacctcttcgccggg
ttcaccatcggcgacttcttccccgagctcgagcccgtcgccagcaccgtcaccggactc
cgccgccgcctcaagaagtgcctcgccgacctccgcgaggcctgcgacgtgatcgtggac
gaacacatcagcggcaaccgccagcgcatccccggcgaccgcgacgaggacttcgtcgac
gtcctcctccgcgtccagaaatcccccgacctcgaggtccccctaaccgacgacaatctc
aaggccctcgtcctggacatgttcgtcgccggcacggacaccacgttcgcgacgctggag
tgggtgatgacggagctagtccgccacccacggatcctcaagaaggcgcaggaggaggtc
cggcgagtcgtcggcgacagcggccgcgtcgaggagtcccacctcggcgagctccactac
atgcgcgccatcatcaaggagacgttccggctgcacccggcggtgccgttgctagtgccg
cgcgagtccgtcgcgccgtgcacgctgggcggctacgacatcccggcgaggacgcgggtg
ttcatcaacacgttcgccatggggcgcgacccggagatctgggacaacccgctggagtac
tcgccggagaggttcgagagcgccggcggcggcggcgagatcgacctcaaggacccggac
tacaagctgctgccgttcggcggcgggcggcgagggtgccccggctacacgttcgcgctc
gccaccgtgcaggtgtcgctcgccagcttgctctaccacttcgagtgggcgctgcccgcc
ggcgtgcgcgccgaggacgtcaacctcgacgagacgttcggcctcgccacgaggaagaag
gagccgctcttcgtcgccgtcaggaagagcgacgcgtacgagtttaagggagaggagctt
agtgaggtttaa

DBGET integrated database retrieval system