KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os12t0281300-01
Entry
Os12t0281300-01   CDS       T02163                                 

Gene name
Os12g0281300, THIOREDOXIN_H-TYPE_6, TRXH6, PITA, PYRICULARIA_ORYZAE_RESISTANCE_TA
Definition
(RAP-DB) Similar to NB-ARC domain containing protein, expressed.
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
SSDB
Motif
Pfam: NB-ARC Rx_N AAA_16 TniB LRR_8 AAA_22 ATPase AAA_25 SelO AAA_33 NACHT Endotoxin_N
Other DBs
RAP-DB: Os12t0281300-01
Oryzabase: 947
Position
chr12:complement(join(10610827..10611770,10607519..10609361))
AA seq 928 aa
MAPAVSASQGVIMRSLTSKLDSLLLQPPEPPPPAQPSSLRKGERKKILLLRGDLRHLLDD
YYLLVEPPSDTAPPPDSTAACWAKEVRELSYDVDDFLDELTTQLLHHRGGGDGSSTAGAK
KMISSMIARLRGELNRRRWIADEVTLFSARVKEAIRRQESYHLGRRTSSSRPREEVDDDD
REDSAGNERRRFLSLTFGMDDAAVHGQLVGRDISMQKLVRWLADGEPKLKVASIVGSGGV
GKTTLATEFYRLHGRRLDAPFDCRAFVRTPRKPDMTKILTDMLSQLRPQHQHQSSDVWEV
DRLLETIRTHLQDKRYFIIIEDLWASSMWDIVSRGLPDNNSCSRILITTEIEPVALACCG
YNSEHIIKIDPLGDDVSSQLFFSGVVGQGNEFPGHLTEVSHDMIKKCGGLPLAITITARH
FKSQLLDGMQQWNHIQKSLTTSNLKKNPTLQGMRQVLNLIYNNLPHCLKACLLYLSIYKE
DYIIRKANLVRQWMAEGFINSIENKVMEEVAGNYFDELVGRGLVQPVDVNCKNEVLSCVV
HHMVLNFIRCKSIEENFSITLDHSQTTVRHADKVRRLSLHFSNAHDTTPLAGLRLSQVRS
MAFFGQVKCMPSIADYRLLRVLILCFWADQEKTSYDLTSISELLQLRYLKITGNITVKLP
EKIQGLQHLQTLEADARATAVLLDIVHTQCLLHLRLVLLDLLPHCHRYIFTSIPKWTGKL
NNLRILNIAVMQISQDDLDTLKGLGSLTALSLLVRTAPAQRIVAANEGFGSLKYFMFVCT
APCMTFVEGAMPSVQRLNLRFNANEFKQYDSKETGLEHLVALAEISARIGGTDDDESNKT
EVESALRTAIRKHPTPSTLMVDIQWVDWIFGAEGRDLDEDLAQQDDHGYGFFILFPGYNL
QGLLSFFLSLPWLLSLPSMHLQPDLMIV
NT seq 2787 nt   +upstreamnt  +downstreamnt
atggcgccggcggtcagtgcatcgcagggtgtcatcatgcggtccctgacgagcaagctc
gactcgctgctgctgcagccgccggagccgccgccgcctgcgcaaccgtcgtcgctgcgg
aagggggagaggaagaagatcctcctcctcagaggcgatctccgacacctgctagatgac
tactacctcctcgtggagccgccgtcagacaccgcgccaccgccagactcgacggcggcg
tgctgggctaaggaggttcgcgagctctcctacgacgtcgacgacttcctcgacgagcta
acgacccagctcctccaccaccgcggcggcggcgatggcagtagcactgctggtgccaag
aagatgatcagcagcatgatcgcccggcttcgaggggagcttaaccggcggcggtggatc
gccgacgaggtcaccctgttcagcgcccgcgtgaaggaggccattcgccgccaggagagc
taccatcttggcaggcgcacctcgagctcgaggccgagagaagaagtcgacgacgacgat
cgcgaggactccgccggcaacgaacgccgccggtttctgtcgctgacgttcgggatggac
gacgctgctgtgcacggccagctcgttggtagggatatttcgatgcaaaagctcgtccgg
tggctggccgacggcgagccgaagctcaaggtggcttccattgttggatccggaggtgtt
ggcaagacgacgctggccacagaattctatcgtctgcatggccggcggttggatgcgccg
ttcgactgccgggctttcgtgcggacgccccggaagcctgacatgacgaagatcctcacc
gacatgctgtcacagctgcggccacaacatcagcatcagtcttcggatgtttgggaggtt
gatcgactccttgaaactatccggacgcatttgcaagataaaaggtacttcatcataatt
gaagatttatgggcttcatcaatgtgggatattgttagccgtggtttgcctgataataat
agttgcagtagaatactaataacaacagaaattgaacctgtagctttggcatgctgtgga
tataactcagagcacattattaagattgatccactgggtgatgatgtctcaagtcaattg
tttttcagtggagttgttggccaaggaaatgaatttcctggacatcttactgaagtttct
catgacatgataaaaaaatgtggtggcttgccactagcaataactataacagccagacat
tttaaaagccagctgttagatggaatgcagcaatggaatcacatacaaaaatcattgact
acttccaatttgaagaaaaatcctactttgcaggggatgaggcaagtactcaaccttatt
tacaataatcttcctcattgtttgaaagcatgtctgttataccttagcatctacaaagag
gactacataattaggaaggccaacttggtgaggcaatggatggctgaaggtttcatcaat
tccatagaaaataaagtcatggaagaagttgcagggaactattttgatgaacttgttggt
aggggcctggtccaaccagtagatgttaactgcaaaaatgaggtattgtcatgtgtagtg
caccacatggtattaaatttcatcaggtgtaagtcaatagaggagaatttcagcattaca
ttggatcattctcagacgacagtaagacatgctgacaaggttcgccgactctcgcttcac
ttcagcaatgcacatgatacaacaccactagcaggtttgagactctcacaagttcgatcg
atggcatttttcggacaagtcaagtgtatgccttccattgcagattataggcttcttcga
gttctgattctttgtttttgggctgatcaagagaaaacaagctatgacctcacaagcatt
tctgaactgttacaactgagatatctgaagataacaggtaatatcacagttaaacttcca
gagaagatccaaggactacaacacttgcagacactggaagcagatgcaagagcaactgct
gtcctattggatattgttcatacacagtgtttgttgcaccttcgtcttgtactacttgat
ctgctccctcactgtcacaggtacatcttcaccagcatccccaaatggactggaaagctc
aacaatctccgcattttaaacattgcagtcatgcaaatttcccaggatgaccttgacact
ctcaaaggactgggatctctcactgctctttcgctgcttgttcgaacagcgcctgcgcaa
agaatcgtcgctgcgaatgaggggttcgggtctctcaagtacttcatgtttgtctgtaca
gcaccatgcatgacttttgtggaaggagcaatgccgagtgtgcaaagattaaatctaagg
ttcaatgccaacgagttcaagcagtatgactctaaggagacagggttggaacacttggtc
gcccttgcagagatctctgcaagaattgggggcactgatgatgatgaatcaaacaaaact
gaagtggagtctgccttgaggactgcaattcgcaagcatccgacgccgagcactcttatg
gttgatatacaatgggtggattggatctttggtgctgaagggagagacttggatgaagat
ttggcacaacaagatgatcacgggtatggatttttcattctattcccaggttacaactta
caaggattattgagcttctttctttctctgccgtggcttctatctttaccttctatgcat
cttcaacctgacttgatgattgtttga

DBGET integrated database retrieval system