KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os12t0468500-01
Entry
Os12t0468500-01   CDS       T02163                                 

Gene name
Os12g0468500
Definition
(RAP-DB) Similar to predicted protein.
  KO
K05391  cyclic nucleotide gated channel, plant
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    Os12t0468500-01 (Os12g0468500)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:dosa04040]
    Os12t0468500-01 (Os12g0468500)
Ion channels [BR:dosa04040]
 Voltage-gated cation channels
  Cyclic nucleotide-gated channel (CNG)
   Os12t0468500-01 (Os12g0468500)
SSDB
Motif
Pfam: Ion_trans cNMP_binding Ion_trans_2 IQ
Other DBs
RAP-DB: Os12t0468500-01
Position
chr12:join(16702715..16703593,16704177..16704707,16705719..16706531)
AA seq 740 aa
MFGSCGGGYRTQTINGRKGTFVRLEQQEDQERQPAATYTMDGSGGGGRVQHVMDSYFSSA
PKIRTRSVRMAAAGVMSIGGYRAERLKSIGRVFQEDLTNMSQKIFDPQDAFLVRMNRLFV
MACIVSVAVDPLFFYLPAVTATDSNTCIGFDRGLATGATAVRSAIDLFYLARIALQFRTA
YIAPSSRVFGRGELVIDPAAIARRYVRRFFVVDLLSVLPLPQIPIWNFLHRPKGADLLPT
KNALLFIVLVQYIPRLVRFYPITSELKRTTGVFAETAFAGAAYYLLLYMLASHMVGAFWY
LLSIERLDDCWRENCRVLKFHQCKKYMYCGGGNLGQSGFLEWRTMIRQVLVMECAPADEA
GTGFQYGIFTTAIQSGVVSTTNLVAKVLFCLWWGLQNLSTVGQGLKTTHYKGEALFAIFL
AVFGLILMALLIGNMQTYLQSMTLRLEEMRLRRRDSEQWMRHRVLPVDLQERVWRHDQYR
WLETRGVDEDSLVRSLPKDLRRDVKRHLCLRLVRRVPLFANMDERLLDAICERLKPSLCT
EATYILREGDPVDEMLFIIRGRLESSTTDGGRMGFFNRGLLKEGDFCGEELLTWALDPKA
AANLPLSTRTVKAISEVEAFALHADELKFVAGQFRRLHSKQLQQTFRFYSQQWRTWASCF
IQAAWRRHLKRRAAEQRRREEEEEEEAASASSSCQITTTVLVSRFAKNAMRGAQRQRSRR
DANLIVLPKPPEPDFQTMEY
NT seq 2223 nt   +upstreamnt  +downstreamnt
atgtttggcagctgcggcggcgggtacaggacgcagacgatcaacgggaggaaggggacg
ttcgtgcggctcgagcagcaggaggatcaggagcggcagccggcggcgacgtacaccatg
gacggcagcggcggcggcggcagggtgcagcacgtgatggacagctacttctcgagcgcg
cccaagatccggacgcggtcggtgcgcatggcggcggcgggcgtgatgagcatcggcggc
taccgggcggagcggctcaagagcatcggccgcgtgttccaggaggacctcaccaacatg
tcccagaagatcttcgacccgcaggacgcgttcctggtgcggatgaaccgcctcttcgtc
atggcctgcatcgtctccgtcgccgtcgacccactcttcttctacctccccgccgtcacc
gccaccgacagcaacacctgcatcggcttcgaccgcggcctcgccacgggcgccaccgcg
gtgcgctcggccatcgacctcttctacctcgcccgcatcgcgctccagttccggacggcg
tacatcgcgccgtcgtcgcgggtgttcggccgcggcgagctggtgatcgacccggccgcc
atcgcgcggcgctacgtccgccgcttcttcgtcgtcgacctcctctccgtgctcccgctg
ccgcagatccccatctggaacttcctccaccgccccaagggcgccgacctcctgcccacc
aagaacgccctcctcttcatcgtcctcgtccagtacatcccccgcctcgtccgcttctac
cccatcacctccgagctcaagcgcaccaccggcgtcttcgccgagaccgccttcgccggc
gccgcctactacctcctcctctacatgctcgccagccacatggtgggggcgttctggtac
ctgctatcgatcgagaggctggacgactgctggagggagaactgcagggtgctcaagttc
catcagtgcaagaagtacatgtactgcggaggagggaacctggggcagtcgggtttcctg
gagtggaggacgatgatccggcaggtgctggtgatggagtgcgcgccggcggacgaggcc
gggaccgggttccagtacgggatcttcacgacggcgatccagtcgggcgtggtgtcgacg
acgaacctggtcgccaaggtgctcttctgcctctggtgggggctccagaacctgagcacc
gtggggcaggggctgaagacgacgcactacaagggggaggccctgttcgccatcttcctc
gccgtgttcggcctcatcctcatggcgctcctcatcggcaacatgcagacgtacctgcag
tcgatgacgctgcggcttgaggagatgcggctgcggcgccgcgactcggagcagtggatg
cgccaccgcgtgctccccgtcgacctccaggagcgcgtgtggcggcacgaccagtaccgg
tggctggagacgcggggcgtggacgaggacagcctcgtgcgcagcctccccaaggacctg
cggcgggacgtgaagcggcacctctgcctccgcctcgtccgccgcgtgccgctgttcgcc
aacatggacgagcgcctcctcgacgccatctgcgagcgcctcaagcccagcctgtgcacg
gaggccacctacatcctccgggaaggggaccccgtggacgagatgctgttcatcatccgc
gggaggctggagagctccaccacggacggcgggaggatggggttcttcaaccggggcctc
ctcaaggaaggggacttctgcggggaggagctcctgacgtgggcgctcgaccccaaggcc
gccgccaacctgccgctgtcgacgcgcaccgtcaaggccatctccgaggtggaggcgttc
gcgctccacgccgacgagctcaagttcgtcgccgggcagttcaggcggctgcacagcaag
cagctgcagcagacgttccggttctactcgcagcagtggcgcacctgggcgtcctgcttc
atccaggccgcctggaggaggcacctcaagcgcagggccgccgagcagcgccgccgcgag
gaggaggaggaggaggaggccgcgtcggcgtcgtcgtcctgccagatcaccaccaccgtc
ctcgtatcgcgcttcgccaagaacgccatgcgcggcgcgcagcggcaacggtcgcgccgg
gacgccaacctcatcgtcctgcccaaaccgccggagcctgacttccagaccatggagtac
tga

DBGET integrated database retrieval system