KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os12t0488900-01
Entry
Os12t0488900-01   CDS       T02163                                 

Gene name
Os12g0488900
Definition
(RAP-DB) Armadillo-like helical domain containing protein.
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
SSDB
Motif
Pfam: PUF INT_SG_DDX_CT_C
Other DBs
RAP-DB: Os12t0488900-01
Position
chr12:complement(join(18318868..18318895,18316583..18318158,18316353..18316515,18315872..18316035,18315533..18315791,18315328..18315447))
AA seq 769 aa
MRAPPARVGDCCPATEMDEVPGNQEDPRLGAYADKITDAMFADHVELGSHYAGDSSSEAG
WAPMIARMQSQSQLGSNQLGVSFENGSLPDDPASLASAFKNMSLGFRDFTVGTPANPVSV
APLGGHYPASHVISSGETTMNSFHQQEFAQDGFRPSSLNPNVAEYMKPKYGVHNVQMCTG
LHGSDYVSGDPYNLPSSASPLQKQYFIDGQFRANAPYQQTGSNFMRQDFDADSHYLLQSQ
YAYQQMPQVAGSDVHWVRSNQHGVHSSIPAASPYLRTPMVGQQAHSSADTYWNGAAISHG
NNQLNSTFVNNCSCIIYPDCSREICEYCQMKQAEKLKHRYMFRRSSKGFLQPQIFDKVNI
KCFPGKTMVKSDDINSARNIQSVFEPNGRIEMNQRINQHGHNQHLNIQGNDFLLFDRLNS
QALSPVESEYGLAMKIPQMSYSSVDEVVGKIHLLAKDQNGCRFLQRIFTEGTSENVKKVF
DGIIEHIGELVVDPFGNYLVQKLLEECNHDQKMHIVYEITKRPGQLIKFSCDMHGTRVVQ
KVIETINSPDEVSMVVCALSSGAITLMMDANGCHVALRCLQKFSHEHKAFLLNVAMEYYF
ELAQDRQGCCIIQKCILHANKEQKNQLLYNITSRALELSEHQYGNYVVQYILDLHISWAT
DEILDKLEDHFGSLSMQKSSSNVVEKCLKEASWPKRVKIIHELINDPKLLHILIDPYGNY
VIQTALKECEDAAVRAVLIGAIRPHVAALRNNMFGKRILSKTYLKNRKH
NT seq 2310 nt   +upstreamnt  +downstreamnt
atgcgcgcgccccctgcgagggttggagattgttgtcctgctactgagatggatgaagtg
ccgggtaatcaagaagatcccagacttggggcctatgccgacaagatcactgatgcgatg
tttgcggaccatgtggagttggggtctcattatgcaggtgattcttcttcagaggcagga
tgggctccaatgatcgcgagaatgcagtcgcagtcgcagctggggagtaaccagcttggt
gtctcctttgagaatggcagtttgccagatgacccggcgtcgttggcatcggcattcaag
aacatgagcttgggattcagggattttactgttggcactcctgctaatcctgtcagtgtt
gcacccctaggtggacattatcctgcaagtcatgtgatttcatctggtgagaccacaatg
aactcatttcatcagcaggagtttgctcaagatggtttcaggccttcatctctgaatccc
aatgttgctgaatacatgaagccgaagtacggtgtacacaatgttcagatgtgcaccggg
ctgcatggctcggattatgtttctggggacccgtataatctaccatcatcagcttcacct
ttacagaaacagtattttattgatgggcaattccgggctaatgcaccatatcagcagact
ggctcgaatttcatgaggcaagattttgatgctgacagtcattatcttttgcaatcccag
tatgcttatcagcaaatgccacaggtcgctggatctgatgttcattgggttagaagcaac
caacatggtgttcactcttctatccctgcagcttcaccttatctcaggacaccaatggtt
ggtcagcaagcacatagcagtgctgatacttactggaatggtgctgctatttcacatgga
aacaaccagctgaattccacatttgtgaacaattgctcatgtataatttaccctgattgt
tcacgcgaaatctgcgaatattgccagatgaagcaagcagaaaagttgaagcatcgttat
atgttcaggcgttcatccaaaggtttcctgcagcctcagatttttgataaggtcaacatt
aaatgttttcctggaaagacgatggtgaagtctgatgatataaattcagcgagaaatatt
cagtctgtctttgaacctaatggccgcattgaaatgaatcagagaattaaccagcatgga
cacaatcaacatcttaatattcagggcaacgatttcttgctttttgacaggctaaactcc
caggctctgtcacctgtggaatctgaatatggtttggccatgaaaattcctcaaatgagt
tatagttcagtagatgaagttgttgggaaaattcatctcttggcaaaggatcagaatggc
tgccgcttcctacagaggatatttacagaaggtacttcggagaatgttaaaaaggtcttt
gatggaatcattgaacatattggtgaacttgtggtcgatccatttggaaactacttggta
caaaagctacttgaagagtgcaaccatgatcagaagatgcatatagtctatgaaataacc
aaaagaccagggcagcttattaaattttcatgcgacatgcatgggacacgtgtagtgcaa
aaggtgatagaaacaataaactcgccagatgaagtttccatggttgtatgtgccctgagc
tctggtgccatcactttgatgatggatgcaaatggctgtcatgttgcactccgctgcttg
caaaaattctcacatgagcacaaagcattccttcttaatgtggccatggaatattacttt
gagctagcccaggatcgtcaaggttgttgtatcattcaaaaatgcattcttcatgcaaat
aaggaacagaagaaccagttgttgtacaatatcacttccagggctcttgagctgtcagag
catcagtatgggaactatgttgtacagtatattcttgatctccacatttcatgggcgaca
gatgaaatactggacaagctggaagatcatttcggatctctgtcgatgcaaaaaagtagc
agcaatgtggtagagaaatgtttaaaagaagcatcgtggcctaaacgtgttaaaatcatt
cacgagcttatcaatgaccctaagttactgcatatcttgatcgacccatatgggaactat
gtgatccaaacagcgctcaaggagtgtgaggatgctgcagtacgcgctgtgctgatcgga
gccattaggccacatgttgctgctcttcgaaacaacatgtttgggaagagaattctgtca
aaaacttacctgaagaacaggaagcactaa

DBGET integrated database retrieval system