KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os12t0555600-01
Entry
Os12t0555600-01   CDS       T02163                                 

Gene name
Os12g0555600, ND1, NARROW_LEAF_AND_DWARF_1
Definition
(RAP-DB) Cellulose synthase-like protein, Cell wall biosynthesis
  KO
K00770  1,4-beta-D-xylan synthase [EC:2.4.2.24]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa00520  Amino sugar and nucleotide sugar metabolism
dosa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Os12t0555600-01 (Os12g0555600)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dosa01003]
    Os12t0555600-01 (Os12g0555600)
Enzymes [BR:dosa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.24  1,4-beta-D-xylan synthase
     Os12t0555600-01 (Os12g0555600)
Glycosyltransferases [BR:dosa01003]
 Polysaccharide
  Structural polysaccharide
   Os12t0555600-01 (Os12g0555600)
SSDB
Motif
Pfam: Cellulose_synt Glyco_trans_2_3 zf-RING_4 Glycos_transf_2 Glyco_tranf_2_3 Prok-RING_4
Other DBs
RAP-DB: Os12t0555600-01
Position
chr12:complement(join(22606114..22607093,22603194..22605861))
AA seq 1215 aa
MSRRLSLPAGAPVTVAVSPVRSPGGDAVVRRGSGLTSPVPRHSLGSSTATLQVSPVRRSG
GSRYLGASRDGGADESAEFVHYTVHIPPTPDRATASVASEAEAAAEAEEVHRPQRSYISG
TIFTGGLNCATRGHVLNFSGEGGATAASRAAASGNMSCKMRGCDMPAFLNGGRPPCDCGF
MICKECYAECAAGNCPGCKEAFSAGSDTDESDSVTDDDDDEAVSSSEERDQLPLTSMARK
FSVVHSMKVPGAAANGNGKPAEFDHARWLFETKGTYGYGNALWPKDGHAHSGAGFVAADE
PPNFGARCRRPLTRKTSVSQAILSPYRLLIAIRLVALGFFLAWRIRHPNPEAVWLWAMSV
ACEVWFAFSWLLDSLPKLCPVHRAADLAVLAERFESPTARNPKGRSDLPGIDVFVTSADP
EKEPPLVTANTILSILAADYPVEKLACYLSDDGGALLSFEALAETASFARTWVPFCRKHG
VEPRCPEAYFGQKRDFLKNKVRVDFVRERRKVKREYDEFKVRVNSLPEAIRRRSDAYNAG
EELRARRRQQEEAAAAAAAGNGELGAAAVETAAVKATWMSDGSHWPGTWTCPAADHARGD
HAGIIQAMLAPPTSEPVMGGEAAECGGLIDTTGVDVRLPMLVYVSREKRPGYDHNKKAGA
MNALVRTSAIMSNGPFILNLDCDHYVHNSSALREGMCFMLDRGGDRVCFVQFPQRFEGVD
PSDRYANHNLVFFDVSMRAMDGLQGPMYVGTGCVFRRTALYGFSPPRATEHHGWLGRRKI
KLFLTKKKSMGKKTDRAEDDTEMMLPPIEDDDGGADIEASAMLPKRFGGSATFVASIPVA
EYQGRLLQDTPGCHHGRPAGALAVPREPLDAATVAEAIGVISCFYEEKTEWGRRIGWIYG
SVTEDVVTGYRMHNRGWRSVYCVTPRRDAFRGTAPINLTDRLHQVLRWATGSVEIFFSRN
NALFASPRMKLLQRVAYFNAGMYPFTSVFLLAYCLLPAVSLFSGKFIVQRLSATFLAFLL
VITLTLCLLALLEIKWSGITLHEWWRNEQFWVIGGTSAHPAAVLQGLLKVIAGVDISFTL
TSKPGNGGGDGGVGGEGNDDEAFAELYEVRWSYLMVPPVTIMMVNAVAIAVAAARTLYSE
FPQWSKLLGGAFFSFWVLCHLYPFAKGLLGRRGRVPTIVFVWSGLISMIISLLWVYINPP
AGARERIGGGGFSFP
NT seq 3648 nt   +upstreamnt  +downstreamnt
atgtcgcggcggctgtcgttgccggcgggggcgccggtgacggtggcggtgtcgccggtg
cggagcccggggggtgacgcggtggtgaggagggggagcgggctgacgtcccccgtgccg
aggcactcgctcgggtcgtccaccgccacgctgcaggtgtcgccggtgaggcggagcggc
gggagtaggtacctcggcgcgtcgagggatggcggcgccgatgagagcgccgagttcgtg
cactacaccgtgcacatcccgcccacgcccgaccgggcgacggcgtccgtggcgagcgag
gcggaggcggcggcggaggccgaggaggtgcaccggccgcagcggagctacatctccggg
acgatattcaccggggggctcaactgcgccacgcgcggccacgtgctcaacttctccggc
gagggcggcgccaccgccgcctccagggcggcggcgtcggggaacatgtcgtgcaagatg
cgcgggtgcgacatgcccgcgttcctcaacggcggccgcccgccgtgcgactgcgggttc
atgatctgcaaggagtgctacgcggagtgcgccgcgggcaactgccccggttgcaaggag
gccttctccgcgggctccgacaccgacgaatccgactccgtcaccgacgacgacgacgac
gaggccgtctcctcctccgaggagagggaccagctgccgctgacatccatggcgaggaaa
ttttccgtggtgcactccatgaaggtccccggcgccgccgccaacggcaacggcaagccg
gccgagttcgaccacgcccgctggctcttcgagaccaagggcacctatggctacggcaac
gctctctggcccaaggacggccacgcccatagcggcgccggcttcgtcgccgccgacgag
ccccccaacttcggtgcccgctgccgccgccccctcaccagaaaaaccagcgtctcccaa
gccattctcagcccctacaggttgttgattgcgattcggctggtggcgctggggttcttc
ctcgcgtggaggattcggcatccgaatccggaggcggtgtggctgtgggcgatgtcggtg
gcgtgcgaggtgtggttcgccttctcatggctgctcgacagcctccccaagctctgcccc
gtccaccgcgccgccgacctcgccgtcctcgccgagcggttcgagtcgccgacggcgcgc
aaccccaagggccgctccgacctccccgggatcgacgtgttcgtcaccagcgccgacccg
gagaaggagccgccgctggtcaccgccaacaccatcctctccatcctcgccgcggactac
cccgtcgagaagctcgcttgctacctctccgacgacggcggcgcgctgctgtcgttcgag
gcgctcgccgagacggccagcttcgcgcgcacgtgggtgccattctgccgcaagcacggc
gtcgagccgcggtgccccgaggcgtatttcggccagaagagggacttcctcaagaacaag
gtgcgcgtcgacttcgtccgcgagaggcggaaggtgaagcgcgagtacgacgagttcaag
gtgcgggtgaactcgctccccgaggcgatccggcggcgctccgacgcgtacaacgccggc
gaggaactgcgcgccaggaggcggcagcaggaggaggccgccgccgcggctgccgccggc
aacggcgagcttggagcggcggcggtcgagaccgccgccgtgaaggccacgtggatgtcg
gacggctcgcactggccggggacgtggacgtgccccgcggcggaccacgcccgcggcgac
cacgccgggatcatccaggcgatgctggcgccgccgacctcggagccggtgatgggaggc
gaggcggcggagtgcggcgggctgatcgacaccacgggcgtggacgtccgcctcccgatg
ctggtgtacgtgtcgcgggagaagcgcccgggctacgatcacaacaagaaggccggcgcc
atgaacgcgctggtgcggacgagcgccatcatgtcgaacgggcccttcatcctcaacctc
gactgcgaccactacgtgcacaactcgtcggcgctccgggaggggatgtgcttcatgctc
gaccgcggcggcgaccgcgtgtgcttcgtccagttcccgcagcggttcgagggcgtcgac
cccagcgaccggtacgccaaccacaacctcgtcttcttcgacgtgtccatgcgcgccatg
gacgggcttcagggccccatgtacgtcggcaccggctgcgtcttccgccgcaccgcgctg
tacggcttcagcccgccccgcgccaccgagcaccatggctggctcggccgcaggaagatc
aagctgttcctcaccaagaagaagagcatgggcaagaagacggacagggccgaggacgac
accgagatgatgctgccgccgatcgaggacgacgacggcggcgccgacattgaggcctcg
gctatgctaccgaagcggttcggcgggtcggcgacgttcgtggcgtcgatacccgtggcg
gagtaccagggtcggctgctgcaggacacccccgggtgccaccacggccgccctgcgggc
gcgctcgctgtgccgcgcgagccgctcgacgcggcgacggtggcggaggccatcggcgtg
atctcctgcttctacgaggagaagacggagtgggggcggcgcatcgggtggatctacggc
tccgtcaccgaggacgtggtcaccggctaccggatgcacaaccgcgggtggcgctccgtc
tactgcgtgacgccgcggcgcgacgcgttccgcggcacggcgccgatcaacctcaccgac
cgcctccaccaggtgctccggtgggcgacgggctccgtcgagatcttcttctcccgcaac
aacgccctcttcgcctcgccgcggatgaagctgctgcagcgcgtcgcctacttcaacgcc
gggatgtaccccttcacctccgtgttcctcctcgcctactgcctcctcccggccgtctcc
ctcttctccggcaagttcatcgtgcagcgactcagcgccaccttcctcgccttcctcctc
gtcatcaccctcaccctctgcctcctcgccctgctcgagatcaagtggtccgggatcacg
ctccacgagtggtggcgcaacgagcagttctgggtgatcggcggcaccagcgcgcacccg
gccgccgtgctgcagggcctactcaaggtgatcgccggcgtggacatctccttcacgctg
acctccaagccggggaacggcggcggcgatggcggggtcggcggcgaggggaacgacgac
gaggcgttcgcggagctgtacgaggtgaggtggagctacctgatggtgccgccggtgacg
atcatgatggtgaacgcggtggcgatcgcggtggcggcggcgaggacgctgtacagcgag
ttcccgcagtggagcaagctgctcggcggcgccttcttcagcttctgggtgctgtgccac
ctctacccgttcgccaagggcctcctcggccgccgcggccgcgtgcccaccatcgtcttc
gtctggtcgggcctcatctccatgatcatctccctcctctgggtctacatcaacccgccc
gccggcgcccgggagcgcatcggcggcggcggattcagcttcccatag

DBGET integrated database retrieval system