KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os12t0576700-01
Entry
Os12t0576700-01   CDS       T02163                                 

Gene name
Os12g0576700
Definition
(RAP-DB) Similar to Diphosphonucleotide phosphatase 1 precursor.
  KO
K22390  acid phosphatase type 7
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99999 Others
    Os12t0576700-01 (Os12g0576700)
SSDB
Motif
Pfam: fn3_PAP Metallophos Metallophos_C Pur_ac_phosph_N Metallophos_2 PhoD
Other DBs
RAP-DB: Os12t0576700-01
Position
chr12:complement(join(23814040..23814201,23813846..23813937,23813691..23813757,23813447..23813569,23813229..23813321,23812941..23813070,23812418..23812499,23812205..23812337,23811895..23812100,23811695..23811820,23811297..23811606,23810751..23811062))
AA seq 611 aa
MIRLWVVVTWLVLWAAAAVHPGEQPLSRIAVERMVLAVNESAHVRASPLVLGLKGETNEW
VEVEFFNPNPSNTDWVGVFSPADFSSAICEAYGVPQYYPMLCTAPIKYQYANFNNNGYSK
SGKGKLKLQLINQREDFSFALFSGGLENPKLVAVSNKIAFANPKAPVYPRLAQGKSWNEM
TVTWTSGYDFKEAVPFVEWGAKGGQRVLSPAGTLTFDRNSMCGAPARTVGWRHPGYIHTS
YLKELWPDSLYTYRLGHRLPNGTHIWSKSYSFKASPYPGQDSVQRVVIFGDMGKAEADGS
NEFNDFQPGSLNTTYQIIRDLKNIDMVVHIGDICYANGYLSQWDQFTAQIEPIASTVPYM
IGMGNHERDWPGTGSFYGNLDSGGECGVPAQTVFYTPAENRAKLWYATDYGMFRFCIANT
EEDWRPGTEQYKFIEQCLSSVDRQKQPWLIFLAHRVLGYSSCTFYEEEGTFEEPMGRESL
QELWQKYKVDLAFYGHVHNYERTCPVYQNKCVVSGSDHYSGPFTATTHVVVGGAGAGTSD
SEFTTSNIKWSYYRDFDYGFVKLTALNHSSLLFEYKKSSDGNVYDHFTISRDYRDILACS
IDNCPRTTLAT
NT seq 1836 nt   +upstreamnt  +downstreamnt
atgatcaggctgtgggtggtggtcacatggctggttctttgggccgcagctgcggtgcac
cccggggagcagccgctgtcgaggattgccgtcgagaggatggtccttgccgtcaacgag
tcggcacatgtcagggcgtcccctttggttcttgggctgaagggtgagaccaatgaatgg
gtagaggtagagttcttcaatccaaacccctccaatactgactgggttggagtgttttct
cctgctgattttagttctgcaatctgtgaggcttatggtgttccacagtattacccaatg
ctctgcacagcacctatcaagtaccaatatgcaaacttcaataataatggttatagtaag
tctgggaagggcaaactgaagcttcagttgatcaaccagagggaggatttctcatttgct
cttttttctggtggcctcgagaatccaaagctggttgctgtctcaaacaagatcgcattt
gcgaatccgaaggcgcctgtttacccacgtttagctcaagggaagtcttggaatgaaatg
acagtaacttggacaagtgggtacgattttaaagaagcagttcctttcgtcgaatggggc
gcgaaagggggacaacgggtcctttctccagctggaacattaacatttgacagaaatagc
atgtgtggtgcaccggcacgaactgtcggttggcgccatcctggttacattcatacaagc
tacttgaaagaactgtggccagattcactgtatacttacagacttggccataggttacca
aatggtactcacatctggagtaagtcatacagcttcaaagcatcaccttatcctgggcaa
gattccgttcagagagtagtcatatttggagacatgggaaaggcagaggcagacggttca
aatgagttcaatgacttccagccaggatcattgaacactacttaccagatcatcagagac
ctgaaaaacattgacatggttgtccatattggggatatttgctatgcaaatggttacttg
tcgcagtgggatcagttcactgcgcagatcgagccaattgcttcgactgttccatacatg
attggcatgggtaatcatgagagggattggcctggaactggttcattctatggaaacctt
gactctggaggagaatgtggtgttcctgctcaaactgtattctacactcctgctgagaac
cgtgcaaaattatggtatgcgacagactatggcatgttcaggttctgcattgctaataca
gaagaggactggaggccagggactgagcagtacaagttcatcgagcaatgcctatcgtcc
gtcgacaggcagaagcagccatggctcatattccttgcgcaccgagttctcgggtactca
tcctgcaccttttatgaagaagagggtacatttgaggaaccgatgggccgagaatcacta
caggagctttggcagaagtacaaggttgacctcgccttctatggccatgtccacaactat
gaaagaacatgcccagtctatcagaataaatgtgttgttagtggttcagatcattacagt
ggtcctttcaccgcgacaacacatgtggtcgttggaggtgctggtgctggtacctccgac
tcagaattcaccacttcaaatatcaaatggagttactacagggactttgactacggtttt
gtcaagctcacagctttaaatcattcatccttattgtttgagtacaagaaaagcagtgac
ggcaatgtgtatgatcatttcacaatctcacgtgattaccgagacatcctggcttgttca
attgacaactgtcctcggaccacactggctacctaa

DBGET integrated database retrieval system