KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os12t0613000-01
Entry
Os12t0613000-01   CDS       T02163                                 

Gene name
Os12g0613000
Definition
(RAP-DB) Similar to NF-YA subunit.
  KO
K08064  nuclear transcription factor Y, alpha
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dosa03000]
    Os12t0613000-01 (Os12g0613000)
Transcription factors [BR:dosa03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   Heteromeric CCAAT factors
    Os12t0613000-01 (Os12g0613000)
SSDB
Motif
Pfam: CBFB_NFYA
Other DBs
RAP-DB: Os12t0613000-01
Position
chr12:complement(join(25956385..25956412,25955719..25955879,25955051..25955122,25954699..25954863,25953828..25954055))
AA seq 217 aa
MTSVVHDVSGNHGADERQKQQRQGEPEDQQEASVTSTDSHTMVATPSTDYATPYAHHDMA
HAMGQIAYANIDPYYGSLYAAYGGQPMMHPPLVGMHPAGLPLPTDAIEEPVYVNAKQYNA
ILRRRQSRAKAESEKKLVKGRKPYLHESRHQHALKRARGAGGRFLNSKSDDKEEHSDSSS
RDKQDGVAPRDSGQPSTSPSSKGASSAKQNKKSKTSN
NT seq 654 nt   +upstreamnt  +downstreamnt
atgacgtctgtagttcatgatgtttcaggcaaccatggagctgatgagcggcaaaaacag
caaaggcaaggtgaacctgaggaccagcaagaagcctcagttactagtacagatagccat
acaatggtagcaacaccttcaacagattatgcgacaccctatgcccatcacgatatggcc
catgcaatgggccaaattgcttacgcaaatattgatccatattacggaagcctttatgca
gcttatggtggacagcctatgatgcatccaccattggtcgggatgcatccagctggacta
ccactgcctaccgatgcaattgaagagcctgtctatgttaatgcaaaacagtacaatgcc
atattaaggcgtcgacaatctcgagccaaagctgagtctgaaaagaagcttgtcaagggc
cgtaagccatatctccatgagtcacggcatcaacatgccctgaaaagggctaggggagct
ggaggccgatttcttaattcaaaatcggatgacaaggaagagcattctgattccagttcc
agagataaacaggatggagttgcaccccgtgatagtggccaaccgtctacctctccgtct
tcaaagggtgcatcatcagctaaacaaaataagaagtcaaaaaccagtaactaa

DBGET integrated database retrieval system