KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os12t0615900-01
Entry
Os12t0615900-01   CDS       T02163                                 

Gene name
Os12g0615900
Definition
(RAP-DB) WD40/YVTN repeat-like domain containing protein.
  KO
K14830  protein MAK11
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:dosa03009]
    Os12t0615900-01 (Os12g0615900)
Ribosome biogenesis [BR:dosa03009]
 Eukaryotic type
  Pre-60S particles
   Other pre-60S particles
    Os12t0615900-01 (Os12g0615900)
SSDB
Motif
Pfam: WD40 PQQ_2
Other DBs
RAP-DB: Os12t0615900-01
Position
chr12:join(26128863..26129321,26129707..26129998,26130488..26130489)
AA seq 250 aa
ADLGPLLDPAAPVSALAIHSLGPVPRNLLAASDDGLLHLYDAGEGFPLLASLRVFPRHRE
PADALAVHPTGRVALAVGRSGGLAMLNLLRGRRSFSCRLEHPATAIAYAEDGAGGDRFVM
AAEEKVTVHDSEDARIIHEIDCGKRVLAFAPAKKGILYTGGEERGITAWDLSSGKVTSRI
EDAHSTRVKGIVVFDDKNDGSELCNLIASASSDGIIRIWDARMIAKEKTTPLAEANTKAR
LTCLAGSSLN
NT seq 753 nt   +upstreamnt  +downstreamnt
gccgacctcggcccgctcctcgaccccgccgcgccggtctccgccctcgccatccactcc
ctcggccccgtcccgcgcaacctcctcgccgcctccgacgacggcctcctccacctctac
gacgccggcgaggggttcccgctcctcgcctcgctccgcgtcttcccgcgccaccgcgag
cccgccgacgccctcgccgtgcaccccacggggcgtgtcgcgctcgccgtcggccgctcg
gggggcctcgccatgctcaacctcctccgcggccgccgcagcttctcctgccgcctcgag
cacccggccacggcgatcgcctacgccgaggatggcgccggtggggaccgcttcgtgatg
gccgccgaggagaaggtgaccgtgcacgactccgaggatgctaggatcatccatgagatc
gactgcggcaaaagggtgctcgcctttgcgcctgcaaagaagggaatactttacactgga
ggagaggaacgcggtattactgcttgggatctttccagtggcaaggttacatcacgcatt
gaggatgctcattcaactcgtgtgaaagggattgttgtcttcgacgacaagaacgatgga
tctgaactgtgcaacctaattgcttcggcctcatcagatggtataataaggatctgggat
gctcggatgattgcaaaagagaagactactccattagcagaggctaacacaaaagcaagg
ctgacttgtcttgcgggatcatcattgaattga

DBGET integrated database retrieval system