KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os12t0618600-01
Entry
Os12t0618600-01   CDS       T02163                                 

Gene name
Os12g0618600
Definition
(RAP-DB) Similar to Transcriptional activator HAP2.
  KO
K08064  nuclear transcription factor Y, alpha
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dosa03000]
    Os12t0618600-01 (Os12g0618600)
Transcription factors [BR:dosa03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   Heteromeric CCAAT factors
    Os12t0618600-01 (Os12g0618600)
SSDB
Motif
Pfam: CBFB_NFYA
Other DBs
RAP-DB: Os12t0618600-01
Position
chr12:complement(join(26350203..26350440,26348981..26349081,26348789..26348857,26348105..26348248,26347469..26347852))
AA seq 311 aa
MMSFNKSQEGFGQVAAVATLASNGGGSLPWLLYGEPLGQGKPAMSPEGVVPRAQTPLDPP
QVPAMDRGVPEILNFSMVPGKGEKCSEHSTTIALQSPFAEYNGCFELGLGQSVVPSNYPY
ADQHYGLLSPYGVRPTPSGRILIPPNMPADAPIYVNAKQCSAIIRRRHARAKAERENRLV
KARKPYLHESRHLHAMRRARGSGGRFLNTKKETNGKTTGGGRKVMDIIIPPLCPAASPSS
EQCNPSSVSSLSGSEVSSIYEHEDMDHFHSFDHLRTHFFTPLPSLMDVEHGAGNPFKWTA
ASDGCCDLLKA
NT seq 936 nt   +upstreamnt  +downstreamnt
atgatgagcttcaacaagagccaagaaggatttgggcaggttgctgctgtggccaccctg
gcctccaatggaggaggctctctaccatggctgctgtacggcgagccactggggcagggg
aagccggccatgtcgccggagggcgtggtgccgagagcacagactcctctggatcctcct
caggttccagccatggacaggggtgtccctgaaattctgaacttctccatggttccaggt
aaaggagaaaaatgttctgagcactcaactactattgctctgcagtcaccatttgcagaa
tataatggctgttttgagctgggccttggtcaatctgtggttccctctaattatccttat
gctgaccagcactatggcctactttctccttatggagtgagaccaacgcctagcgggcga
attcttattccaccaaatatgccagctgatgcaccaatttatgtgaatgcaaaacagtgt
tcagccatcattcgacgtcgccatgctcgtgccaaggcagagagggagaataggctggtc
aaagctagaaaaccatatcttcacgaatcacgccatcttcatgcaatgcgtcgtgcaaga
ggctctggtgggcgcttcctcaacacgaagaaagagaccaatgggaaaaccactggtgga
ggcaggaaggtgatggacatcatcatcccgcctctgtgccccgccgcatctcccagctcg
gagcagtgcaacccaagcagcgtttccagcctgtccgggtcagaggtgtcgagcatatat
gaacacgaagacatggaccacttccatagctttgatcatctccggacacacttcttcacc
ccgctcccgagcctcatggatgtcgagcacggggctggtaaccccttcaagtggacagca
gcctctgatggctgctgtgacctcctcaaagcatga

DBGET integrated database retrieval system