KEGG   Dolichospermum sp. UHCC 0315A: BMF77_01825Help
Entry
BMF77_01825       CDS       T06185                                 

Gene name
hemL
Definition
(GenBank) Glutamate-1-semialdehyde 2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
dou  Dolichospermum sp. UHCC 0315A
Pathway
dou00860  Porphyrin and chlorophyll metabolism
dou01100  Metabolic pathways
dou01110  Biosynthesis of secondary metabolites
dou01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dou00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BMF77_01825 (hemL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:dou01007]
    BMF77_01825 (hemL)
Enzymes [BR:dou01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     BMF77_01825 (hemL)
Amino acid related enzymes [BR:dou01007]
 Aminotransferase (transaminase)
  Class III
   BMF77_01825 (hemL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: QEI41241
UniProt: A0A5C0DPG8
Position
complement(1921146..1922444)
Genome map
AA seq 432 aa AA seqDB search
MVNTTIKTTKSQEIFAAAQNLMPGGVSSPVRAFKSVGGQPIVFDRVNGAYIWDVDGNKYI
DYVGTWGPAICGHAHPEVISALHAALDKGTSFGAPCALENVLAEMVIDAVPSVEMVRFVN
SGTEACMAVLRLMRAFTNREKLIKFEGCYHGHADMFLVKAGSGVATLGLPDSPGVPKSVT
ANTLTAPFNDLEAVKALFEQNPQEIAGVILEPVVGNAGFITPDAGFLEGLRELTQEYGAL
LVFDEVMTGFRIAYGGAQAKFGVTPDLTTMGKVIGGGLPVGAYGGRREIMSMVAPAGPVY
QAGTLSGNPLAMTAGIKTLELLNKPGTYEYLEKITKQLADGLLKICADTGHAACGGHISA
MFGLFFTAGPVHNYEDAKKADTAKFGRFHRGMLEHGIYLAPSQFEAGFTSLAHTSEDIEQ
TLAAAKEVLSNL
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
ttggtaaacaccacaattaaaaccacaaaatcacaagaaatctttgctgctgctcaaaac
ctgatgcccggaggagtcagttctcccgttcgcgcttttaaatccgtcggtggacaaccc
atcgtatttgatcgtgttaatggcgcatatatttgggatgtagacggcaacaaatacatt
gactatgttgggacttggggacctgctatttgtggtcatgctcatccagaagtcatatcc
gcactacacgcagccctagataaaggcacaagttttggcgctccctgcgctcttgaaaac
gttttagccgaaatggtcattgatgccgttcctagcgtcgaaatggtcagattcgttaac
tctggaacagaagcttgtatggcggtattacgcctgatgcgagcctttacaaatcgagaa
aaattgatcaaatttgaaggctgctatcacggacacgcagatatgttcctggtcaaagcc
ggttctggtgttgctaccctgggtttacccgactccccaggagtaccaaaatccgtcaca
gccaacaccttaaccgcgcctttcaatgatttggaagccgtaaaagccttatttgaacaa
aacccccaggaaatcgccggagttattcttgaacccgtagttggtaacgctggttttatt
acccctgatgctggtttcctagaaggactacgggaacttactcaagaatatggggcatta
ttagtatttgatgaagtcatgacaggcttccgcattgcctacggtggcgcacaagccaaa
tttggtgttacccccgacttaactacaatgggtaaagtcattggtggtggtttacccgtc
ggcgcttatggtggccgccgtgagattatgtcaatggttgcccccgcaggcccagtttat
caagcggggactctttccggtaatcctttagccatgacagcgggaattaaaaccctggaa
ctactcaacaaacccggtacttatgagtatttagaaaaaattaccaagcagttagctgat
ggattgctaaaaatctgtgcagatacgggtcatgctgcctgtggtggtcatattagtgcc
atgtttgggctattcttcaccgctggacctgtgcataactatgaagatgccaaaaaggca
gatacagctaaatttggtcgtttccatcgcggaatgttagagcatggtatttacctagcc
ccatctcaatttgaagctggttttacttctttagcacatacttccgaagatattgaacag
acattagctgctgctaaagaggtgctatctaatctgtaa

DBGET integrated database retrieval system