KEGG   Dolichospermum sp. UHCC 0315A: BMF77_04341Help
Entry
BMF77_04341       CDS       T06185                                 

Gene name
cbbL
Definition
(GenBank) Ribulose bisphosphate carboxylase large chain
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
dou  Dolichospermum sp. UHCC 0315A
Pathway
dou00630  Glyoxylate and dicarboxylate metabolism
dou00710  Carbon fixation in photosynthetic organisms
dou01100  Metabolic pathways
dou01110  Biosynthesis of secondary metabolites
dou01120  Microbial metabolism in diverse environments
dou01200  Carbon metabolism
Module
dou_M00165  Reductive pentose phosphate cycle (Calvin cycle)
dou_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
dou_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:dou00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BMF77_04341 (cbbL)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BMF77_04341 (cbbL)
Enzymes [BR:dou01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     BMF77_04341 (cbbL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: QEI43720
UniProt: A0A5C0DZ73
Position
complement(4680469..4681899)
Genome map
AA seq 476 aa AA seqDB search
MSYAQTKTQAKSGYKAGVQDYRLTYYTPDYTPKDTDLLAAFRMTPQPGVPPEEAGAAVAA
ESSTGTWTTVWTDLLTDLDRYKGRCYDIEPVPGEDNQYICYVAYPLDLFEEGSITNVLTS
IVGNVFGFKALRALRLEDIRFPVAYIKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLG
LSAKNYGRAVYECLRGGLDFTKDDENINSAPFQRWRDRFLFVSEAINKAQAETGEIKGHY
LNVTAPTCEQMIQRAEYAKELKQPIIMHDYLTAGFTANTTLSRWCRDNGILLHIHRAMHA
VIDRQKNHGIHFRVLAKALRLSGGDHIHTGTVVGKLEGERGITMGFVDLLRENYIEQDKS
RGIYFTQDWASLPGVMAVASGGIHVWHMPALVEIFGDDSVLQFGGGTLGHPWGNAPGATA
NRVALEAVVQARNEGRNLAREGNDIIREAAKWSPELAVACELWKEIKFEFEAMDTV
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgtcttacgcgcaaactaagactcaggctaagtctgggtataaagctggggttcaagat
tacagactaacttattacacacctgattacactcctaaagatacagatttattagcagct
ttccggatgaccccccaacccggagttcctcctgaagaagctggtgcggctgtagctgct
gagtcttccactggtacttggacaacagtatggacagacttgctcaccgacctagatcgc
tacaaaggtcgttgttacgacatcgaaccagttcccggtgaagataaccaatatatttgt
tatgttgcttatcctttggacttgtttgaagaaggttctatcaccaacgtactaacctcc
atcgtcggtaacgtatttggttttaaagctttacgggcgttacgtttggaagacattcgt
ttccctgtagcttacatcaagactttccaaggacctcctcacggtatccaagtagagcgc
gacaaattgaacaaatacggtcgtcctctgttgggttgtacaatcaagcccaaattaggt
ctttccgctaagaactacggacgcgcagtttacgaatgtttacgtggtggtttggacttc
accaaagacgacgaaaacattaactctgctccattccaaagatggcgcgatcgcttcttg
tttgtatctgaagctatcaacaaagcacaagcagaaacaggcgaaatcaagggtcactac
ctgaacgttaccgctcctacctgcgaacaaatgatccaacgggctgagtacgctaaagaa
ctcaagcagcccatcatcatgcacgattacctgaccgcaggtttcaccgctaacaccaca
ttatctcgctggtgtcgtgataacggtattctgttgcacattcaccgggctatgcacgct
gtaattgaccgtcagaagaaccacggtatccacttccgcgtattagctaaagctctccgc
ttgtctggtggtgaccacattcacaccggtacagtagttggtaagttagaaggtgaacgg
ggaatcaccatgggcttcgttgacctattgcgtgaaaactacatcgagcaagacaagtct
cgcggtatttactttacccaagactgggcttctttacccggtgtaatggcagttgcttct
ggtggtatccacgtatggcatatgcccgcgttggtagaaatctttggtgatgactccgta
ctccaattcggtggtggtactctcggacatccttggggtaacgctcctggtgctacagct
aaccgcgtagctctagaagcagttgttcaagctcgtaacgaaggtcgcaacttggctcgt
gaaggtaacgatattatccgcgaagctgctaagtggtctcctgagttggctgttgcttgc
gaactgtggaaagaaattaagttcgagtttgaagcaatggataccgtctga

DBGET integrated database retrieval system