KEGG   Dendroctonus ponderosae (mountain pine beetle): 109532955Help
Entry
109532955         CDS       T04899                                 

Definition
(RefSeq) alanine--glyoxylate aminotransferase 2-like
  KO
K14286  ethanolamine-phosphate phospho-lyase [EC:4.2.3.2]
Organism
dpa  Dendroctonus ponderosae (mountain pine beetle)
Pathway
dpa00564  Glycerophospholipid metabolism
dpa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    109532955
Enzymes [BR:dpa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.2  ethanolamine-phosphate phospho-lyase
     109532955
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 109532955
NCBI-ProteinID: XP_019753672
Position
Unknown
AA seq 428 aa AA seqDB search
MEQLPKEETIALREKLIGDQMAVLNTNNRFLHDNIVVCAQKIVSTLPNKLEVCFFVNSGS
EANDLALRLAQIHTGHRDVITLEHAYHGHLTSLIDISHYKLNLPGGVGQKKHVHLALCPD
SYRGRYRDNEYSMEEIGTMYADEVGDLCEKSTQNEGGVSAFIAESLLSCGGQVIPPKNYF
SRVYEHVRRAGGVCIADEVQVGFGRIGKHWWAFQNYNVQPDIVTMGKPMENGHPVACVVT
TREIADSFFNTGVEYFNTYGGNPVSCAIANAVFDAIENDNLMEQALIVGEYLLDSCQTLA
KKHKQIGDVRGVGLFVGIDLVDDRDTRKANKECAQIVVQRMREERILVSADGPECNVIKF
KPPMVFTKENVDEVVAMLDRVLTEVKHKERLDAKIKSLQNLVPAIIEEHSNKGQRPVRPI
YKENIKSI
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggaacagctgccaaaggaggaaactatcgccttacgagagaagctgattggcgatcag
atggcggttctaaacaccaacaatcgctttttgcatgacaacatcgtggtgtgcgctcag
aagatcgtcagcactctgccaaataagctggaggtgtgcttcttcgtcaactccggctca
gaagccaacgatctggcgctgagactggcgcagatccataccgggcacagggacgtgatc
accttggaacatgcgtaccatggccatttgacttctttgattgatatttcccactacaag
cttaacctccctggaggcgttggacagaagaaacatgtccatttggcactatgccctgat
agttacagaggaagatatcgcgacaacgagtacagcatggaggaaattggcacgatgtat
gcggacgaagtgggcgatctgtgcgaaaaatccacccagaacgagggcggagtctcggcc
ttcattgccgaaagcctgctaagctgcggaggtcaagtgattcctcccaagaactacttt
agtcgagtttacgagcacgtaagacgcgctgggggcgtgtgcatagcggacgaggtccaa
gttgggttcggtcgcataggaaaacattggtgggcgttccagaactataacgtccagccc
gatattgttactatgggcaaacccatggaaaacggtcatcctgtcgcttgcgttgtcacc
accagagaaatcgccgatagctttttcaacactggagttgaatactttaacacttatggt
ggaaatccggtttcttgtgcaattgccaacgcagtcttcgacgcaatagagaacgacaac
ctgatggaacaagccctgattgtgggcgagtatctgctggacagttgccagacgttggca
aaaaaacacaagcagattggggatgtgcgaggagttggcctgtttgttggaatcgacttg
gtggatgatcgcgacacgaggaaagctaacaaagagtgcgctcaaatagtcgtgcaaaga
atgagagaagaacggattttggtcagtgccgatggtccagaatgtaacgtgatcaagttc
aagccgccgatggttttcaccaaggaaaatgtggatgaagtggttgccatgctggatcgc
gttctcactgaagtgaagcacaaggagagattagacgcaaaaatcaagagtttgcaaaac
ctcgttccggccatcatcgaggagcattccaacaagggccagcggccagtcaggcccatt
tacaaggaaaacatcaagtccatataa

DBGET integrated database retrieval system