KEGG   Dendroctonus ponderosae (mountain pine beetle): 109533106Help
Entry
109533106         CDS       T04899                                 

Definition
(RefSeq) heat shock 70 kDa protein-like isoform X1
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
dpa  Dendroctonus ponderosae (mountain pine beetle)
Pathway
dpa03040  Spliceosome
dpa04141  Protein processing in endoplasmic reticulum
dpa04144  Endocytosis
dpa04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:dpa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    109533106
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    109533106
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109533106
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    109533106
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dpa01009]
    109533106
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:dpa03041]
    109533106
   03009 Ribosome biogenesis [BR:dpa03009]
    109533106
   03110 Chaperones and folding catalysts [BR:dpa03110]
    109533106
   04131 Membrane trafficking [BR:dpa04131]
    109533106
   03051 Proteasome [BR:dpa03051]
    109533106
   03029 Mitochondrial biogenesis [BR:dpa03029]
    109533106
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dpa04147]
    109533106
Protein phosphatases and associated proteins [BR:dpa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     109533106
Spliceosome [BR:dpa03041]
 Complex B
  Other components
   Prp19 complex
    109533106
 Complex C
   Prp19-CDC5 complex
    109533106
Ribosome biogenesis [BR:dpa03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    109533106
Chaperones and folding catalysts [BR:dpa03110]
 Heat shock proteins
  HSP70 / DNAK
   109533106
Membrane trafficking [BR:dpa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    109533106
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    109533106
Proteasome [BR:dpa03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    109533106
Mitochondrial biogenesis [BR:dpa03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    109533106
Exosome [BR:dpa04147]
 Exosomal proteins
  Proteins found in most exosomes
   109533106
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl StbA DUF1464 Hydantoinase_A DDR
Motif
Other DBs
NCBI-GeneID: 109533106
NCBI-ProteinID: XP_019753894
Position
Unknown
AA seq 641 aa AA seqDB search
MDYIKDSTRFVWNLKEKVMGQNKTKVQLPCPIGIDLGTTFSAVAIYRGEKSEMIPNAFGD
KLTPSCVFYNPNISEILVGKIAEERGLTNPENFIFDIKRFIGRRYDDVYVQKLKNSEEYP
FKIVEGNNGQTEIKLRWGKEIVKKSPEEICSEILKNMKESASEYLGATVTEAVISVPAYF
SNAQKKATKAAAKLAGLKVLKLITEPVAAAIHYAQDKLDTDSTLLVFDLGGGTLDVSIIK
VNGHSFAVQSVEGDSFLGGRDFDEMLVNYFKPTIKEKLKNKSNIVNERLLRRIQRNCEKL
KKLLSVARDHSFDLYYSEDDSIKLELSQTQFNQLIDNSVERSAEIIRKCLADAELTTGSI
TDVILVGGSTRIPRIREKLTSMFGSNKIRTNLNPDEAVALGASIQAGVFGNRYKELEKYQ
VKEATPLSLGLEVSGNLMKILIEKNSSLPKKSNPNRYRTMTNNQTSAVFPIYEGERKNCK
YNNLLGEFTIDDLPLGQAGEISFEVVFHLDENGILEVSAQETSTCKHNKLTVTLGEFQLG
VRKIERTIAHAKQHKKDDEMFESFTIYFCKVREICERIIYNLEKINSNTDRCIVESECTK
FWKTIEALQYTEILRLKYAYSSFKMKVSPLTAGVIDVNFIA
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atggattatataaaagatagtacgcgtttcgtctggaatttgaaagagaaggtgatgggg
cagaataaaactaaggtgcagttaccatgtccaataggaatagatctcggtacaacattt
tcggcagtcgccatatatcgcggcgaaaaatctgaaatgattccgaatgcttttggagac
aaattaacaccatcatgcgtattttataatcccaatatttcggagatattggtgggaaaa
attgccgaagaacgtggactcaccaatcccgagaactttattttcgacataaaacggttt
attggaaggaggtacgatgatgtgtacgtacaaaaactgaagaattccgaagaatatccg
tttaagatagttgagggaaataatggtcaaactgaaattaaactacgatggggcaaagaa
atcgtgaaaaaatccccagaggaaatttgttctgaaatactgaagaatatgaaagaatct
gcttcagaatatttaggagcgacggttacagaagcagttatttcagttcctgcctatttc
agtaatgcacaaaagaaggctacaaaagctgcagctaaactagctggtttaaaggtactt
aaattgattactgaacccgtagcagctgccattcactatgctcaagataaactcgatacc
gattcaactctcctggtatttgatttaggaggaggaactctggacgtatcaattattaaa
gtcaatggccattcgtttgccgttcaaagtgtagaaggtgactcatttttaggtggaaga
gatttcgacgaaatgttggtcaattactttaagccaacaattaaagaaaaattaaagaac
aaatcaaacatagtgaatgaaagattactgcgacgaattcagcgtaattgtgaaaagctg
aaaaagttactttcggtagcacgagatcattcttttgatttgtactactcagaagacgat
tcgattaaattggaattgagccagacacaatttaatcaactgattgataattcagttgag
cgatctgcagaaattatcagaaagtgccttgcggacgctgaattaaccacaggaagtatc
accgatgtaatactagttggaggttccactcgtataccaagaattcgagaaaaattaaca
tcgatgttcggctccaacaaaatacgtaccaacctgaatcctgatgaggctgttgctctt
ggtgcaagtattcaagcaggagtatttggaaatagatataaagaactggagaaatatcaa
gtgaaggaagctactcctttatctttgggattagaagttagtggaaatttaatgaaaatt
ttgatagagaagaattcgtcgcttcctaaaaaatcaaacccgaatcgttaccgcactatg
acaaataatcaaacatctgcagtttttccaatttacgaaggagagagaaaaaactgcaaa
tataataatctactgggagagtttaccatagatgacttgcctcttggtcaagctggcgag
atcagttttgaagtagtgtttcatttagacgaaaacggcatattggaagtatccgctcaa
gaaacctcgacatgcaaacataataagctaacagttacactaggagaatttcaacttggt
gtgcgcaaaatagaaagaacaatcgcccacgcaaaacaacataagaaggatgatgagatg
tttgaatcatttacgatttatttttgtaaagtaagagaaatttgcgaacgtataatttat
aatttggagaaaattaattctaacactgatcggtgtattgtagaatcagagtgtacgaaa
ttttggaaaaccatagaagcactccaatatacagaaatattacggttgaaatatgcctac
agctcctttaaaatgaaagtatccccgttgactgctggtgtcatagacgtgaattttatc
gcttaa

DBGET integrated database retrieval system