KEGG   Dendroctonus ponderosae (mountain pine beetle): 109534352Help
Entry
109534352         CDS       T04899                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD12 isoform X1
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
dpa  Dendroctonus ponderosae (mountain pine beetle)
Brite
KEGG Orthology (KO) [BR:dpa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:dpa01002]
    109534352
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dpa04147]
    109534352
Enzymes [BR:dpa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     109534352
Peptidases [BR:dpa01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   109534352
Exosome [BR:dpa04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   109534352
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Peptidase_S9 Abhydrolase_3 Abhydrolase_2 FSH1 Thioesterase Lipase_3 LIDHydrolase DUF3357 DUF2974
Motif
Other DBs
NCBI-GeneID: 109534352
NCBI-ProteinID: XP_019755563
Position
Unknown
AA seq 381 aa AA seqDB search
MNNHRYNDYYLVNDEDFANDDDSVELMPTKRRKVKRVFCILVVVFSGLLVLGFLAAFVGL
PLVFKFSLALQQSLIFTRFGLQTNATYYGNFRLPEYKNHYVPVIDVDNKTTLKLGLWHIL
PLDLAEISFYNESYDFDKVLKHSNYSVLLYFHGTGEDRSQSWQKYQLLRSFFHVIAFDYR
GYGDSQPGEMLENNVVNDCVQVYKWLQNRTESPIYIWGHSLGANLATSTVARLDQNANLT
GLILEAAFTSLTDELYFHPYVKYLKWLPWFWDTVVKPLQHNGFLFDTTKHIEMVQCPILF
LHAKDDEIVPYFMSQALYTASKKRNVSEWVLNDTKLVLFNAKIGLNHYFIYRDSFTFFHI
LDFLNHCSQNLQLSLEGSHQS
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaacaatcacagatataatgactattacttggtgaacgatgaggatttcgctaatgat
gacgacagcgttgaactaatgcctaccaaaagacgtaaagtgaaaagggtcttttgtatt
ttggttgttgtttttagtgggttgctggttctgggatttctcgctgcgttcgttggacta
cctttggtttttaagttctcactggctttgcaacaatccttgatctttacccgatttggt
cttcaaacaaatgcaacgtattatggcaatttccggctgccagaatacaagaaccactat
gtaccagtaatagatgtggataacaagacaaccttaaagttggggctgtggcacatcctc
ccgctagatcttgcagagatttcgttttacaatgaatcgtacgactttgacaaagttctg
aaacacagcaactatagtgtcctgctgtatttccatggcaccggtgaagaccgcagtcag
agctggcagaaataccaattgctaagaagctttttccacgtcattgctttcgattacaga
ggttacggcgactcccagccaggtgagatgcttgagaacaacgtggttaatgactgcgtc
caagtgtacaaatggctccagaacagaacagagagccccatttatatatggggccactca
ttgggtgcaaatctggctacgagcaccgtggctcggctagaccaaaatgccaacttaact
ggactcattttggaggcagcctttaccagtttgaccgatgaattgtattttcatccttac
gtgaagtatcttaagtggctgccttggttttgggatactgtcgtcaaacctctgcagcat
aatggattcctatttgataccactaaacatattgaaatggtgcagtgtcctatactgttt
ctccatgctaaagatgatgaaattgtgccgtattttatgagccaagccttatataccgcc
tcgaaaaaacgaaatgtctctgaatgggtgctaaacgatacgaagcttgttctattcaat
gccaagattggactgaatcactattttatttatcgggactctttcacatttttccacata
ctggattttctgaatcattgctcccagaacctgcaactctcacttgaaggctcacatcaa
agttaa

DBGET integrated database retrieval system