KEGG   Dendroctonus ponderosae (mountain pine beetle): 109534856Help
Entry
109534856         CDS       T04899                                 

Definition
(RefSeq) receptor-type guanylate cyclase gcy-28
  KO
K12323  atrial natriuretic peptide receptor A [EC:4.6.1.2]
Organism
dpa  Dendroctonus ponderosae (mountain pine beetle)
Pathway
dpa00230  Purine metabolism
dpa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109534856
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dpa01001]
    109534856
Enzymes [BR:dpa01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     109534856
Protein kinases [BR:dpa01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   109534856
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor Pkinase_Tyr Pkinase
Motif
Other DBs
NCBI-GeneID: 109534856
NCBI-ProteinID: XP_019756193
Position
Unknown
AA seq 595 aa AA seqDB search
MSYCQCRLKKVFSSIFHQFGWKHIALILDRSDLFSLTVGKNLEHGLKKAGLLSFVRELDG
NENDSLDNYLRDASMYARVVILSVRGALVRKFMLAAHALGMTKGDWIFLDVEIFQGSYWG
DHDWKAGDSEDYKARKAYEALLRVSLLQPTSDKFQDFADKVKERSLRDYNYTISEGEEVN
FVIGAFYDGVFLLGMALNETLWEGGDIRDGSDITLKMWNRTFSGITGHVRIDDNGDRDAD
YSILDLDPITGKFEVVGHYNGLNKRYAHVAGKRIHWPGGREGPPPDVPKCGFLDDNPECR
DREAYMIVIYGSFALAAFLAFTSTLICVAYKHMKTSADLNNMSWRIRPEEVILEPGRTFG
SKLALQKLSDTYGLTSCRESITSNTSLPSAKIYTTVGIYKGSRVAIKKITKKKIDITKKL
LWEIKQVRDVTHENTVRFLGACIECPTILVLTEYCCRGSLRDVLENEDIHLDWNFRMSLI
YDIVKGMSYLHGCDISFHGKLRSCNCLIDGRFVLKISDFGLTSLSIPVDVIKDTSYFNKM
LWVAPELLPLTLVPGNPATQKGDVYSFGIILEEIIVRGGPYEAARRYLEVEGKKI
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtattgccagtgcaggctgaaaaaggtgttttccagcatcttccatcagtttgga
tggaagcatatcgccctcatcctggatcgatctgatctgttttcgcttacagtgggcaaa
aacttggagcacgggctgaaaaaagcaggacttctctcattcgtgcgcgagttggacggc
aacgaaaacgactccctggacaactaccttcgcgatgccagcatgtatgctagagtggtc
attctgagcgtccggggggcgctggttaggaagttcatgctggcagcgcacgctctgggc
atgaccaaaggggactggatctttttggacgtggaaatattccagggctcctattggggc
gaccacgactggaaggccggcgactcagaagactacaaagcgcgcaaggcctacgaggcc
ctgctcagagtgtccctcttgcaaccaaccagcgacaagttccaggactttgccgacaag
gtcaaggaaaggtctcttagggactacaattacacgatcagcgaaggggaggaggtaaac
ttcgtgattggggctttctatgatggcgttttcctgctgggcatggcccttaacgagact
ctatgggaagggggcgacattagggacggcagcgacatcacccttaaaatgtggaaccgg
actttttcaggtatcacgggtcatgtgcgcatcgacgacaacggcgatcgagacgccgac
tactcgatcctggacctggacccgatcaccggcaaatttgaggtggtgggccattacaac
gggttgaacaagcggtatgcgcatgtggcgggcaagcgcatccattggccgggaggacgc
gaaggaccgcccccggacgttccaaagtgcggctttctggacgacaatcccgagtgcagg
gaccgagaggcttacatgatagtgatttatggatcgtttgctttggcggcttttctggcg
tttacctccacattgatctgcgttgcttataagcacatgaagacatcagccgatctcaac
aacatgtcgtggcgaatccggccagaagaagtgattttagagccggggcgcactttcggc
tccaaactggcgttgcagaagctctcagacacctacggcctgacaagttgcagagaatca
atcacctccaacacttctctaccgtcggcgaaaatctacaccaccgtgggcatttacaag
ggcagtcgggtggccatcaagaagatcaccaagaagaaaatcgacatcaccaagaagttg
ctatgggaaattaaacaggtaagagatgtgacccatgagaacacggtgcgattcttgggc
gcctgcatcgagtgccccacgatcctcgtcttgaccgagtactgctgcagaggcagctta
agggacgtgctggaaaatgaggacattcacctggactggaacttcaggatgtcgctaata
tacgacatagtcaagggcatgagctacttgcacggttgcgacatctcctttcacggcaaa
ttgcgctcctgcaactgtctaatcgacggccggtttgtgctgaaaatctccgactttggg
ctcacctcgctcagcatccctgtggatgtcatcaaggacaccagttattttaacaaaatg
ttgtgggtcgctcccgagcttctgcccttaactcttgtgccaggcaatccagccacccaa
aaaggcgacgtgtacagctttggcattatactggaagaaatcattgtgcgcggcggtcct
tatgaggctgccagaaggtatctggaggttgaaggtaagaagatttga

DBGET integrated database retrieval system