KEGG   Dendroctonus ponderosae (mountain pine beetle): 109535170Help
Entry
109535170         CDS       T04899                                 

Definition
(RefSeq) receptor-type guanylate cyclase Gyc76C-like isoform X1
  KO
K01769  guanylate cyclase, other [EC:4.6.1.2]
Organism
dpa  Dendroctonus ponderosae (mountain pine beetle)
Pathway
dpa00230  Purine metabolism
dpa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109535170
Enzymes [BR:dpa01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     109535170
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc ANF_receptor Pkinase_Tyr Pkinase Peripla_BP_6 HNOBA
Motif
Other DBs
NCBI-GeneID: 109535170
NCBI-ProteinID: XP_019756594
Position
Unknown
AA seq 1477 aa AA seqDB search
MRLGLASLLVTLLLCLSRAESVLPPPDWSPVTTQPSYQTNRLTFFPYSNDSFETDNQFSD
GDSHFIDESHELRENLTVGDLKKEPMAEKVKLILGYLTAVKGDLKERQGLAISGAISMAV
EEINNDPDILPNVTLEVRWNDTRGETVLATRAMTDMMCEGVAAFFGPEGSCFVEGIVSQA
RNIPMISYKCSDYRASKIPTFARTEPPDTQVTKSIVSLLNYYNWNKFSIIYEEGWETVAT
SLEKQAEGKNMSVQHKKNAGDRHKCCLQNYKCCQSGFWYEIIQNSKNKTRIYVFLGTSIS
LVDFMDTMQRAQLFENGEYIVIYVDMNTYLEKEVHKYIYKFDELEKYKNCKELSDYPSLV
TRVKSLFVVVPTAPTENYKNFSEKVRNYNKMEPFDFQTVFPSEKGKIFISFQKFVSIYAA
YLYDSVKLYASALHHLLIDQPILNEKTIREIATNGTKIIETIIQINQTYRSITGAVIKLD
KNGDSEGNFSVLAYRETEQLYLGGSNNFSCSFYMAPVGQFYQNEKSAYPQYKINPSTSIM
WPGGDKPNDEPSCGFDNKLCQKTDTHRNSLIAAGILGMVLFCAGVVTMSIYRKWKIEQEI
EGLLWKIDRDDIHSYFEKDNISSPSRMSLCSVSVTSYESKGGLQVFTTTAQYRGVVVRIK
DLAFSRKKDISREIMKEMRLLRDLRHDNVNSFIGACVQPTSLLLVTDYCAKGSLYDIIEN
EDIKLDKMFIASLVHDLVKGMLYLHNSMLLCHGNLKSSNCVVTSRWVLQVTDFGLGELRQ
LAAMESEEEHQTYRNLLWKAPELLRFPEKFIKGTPQGDVYAFGLILYEILGRRAPFGDVD
DELKDIVLSIKNPKEGQPLMRPDADILHNPEIGCDEYVLEVMKECWSESPECRPDFPSIR
SRLKRMKDGKSKNIMDQMMDMMETYATNLEELVYERTRLLYEEKNKTEDLLHRMLPEPVA
DKLTKGYGIEPESFDLVTIYFSDIVGFTAMSAESTPLQVVNFLNDLYTVFDRIIKGYDVY
KVETIGDAYMVVSGLPIRNGDRHAGEIASMALDLLSAVRNHSIAHRPNETLKLRIGIHTG
PVVAGVVGLTMPRYCLFGDTVNTASRMESNGEPLKIHISMQCKDALEKLGGYTIEERGLV
SMKGKGEVETFWLVGATEQAIQRKEVDLTELPPPLFCRPRRSPKLNNESRQPSIIGGFGG
LNSRRHSSVPRGTSIELESSSTLQNYSPMVQSRHFLKVNRNNLHVPDPGGSKLTINTTFG
SQILEKPEEGRQKPRPRRVLSSIASSSEEPHKSYGGLNKVRESKSLDPLPFVARPATTAK
DLIDSFLTGRKRSTKSLDNCDKCGEIQIIAIPKDKMVNNNFPNGNLLNMPQEEQHGFIED
AQVPLLKPPKVQNPLIVRRRGGSDVNKFLVSDCSKAKLTHSLDALPTTENQLAPKSSFTK
WLVGIFSGNSLKSSNASLKKGVLNDYSIQAPDNESMV
NT seq 4434 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctaggcctggcttctctgctggtcacgctgctactgtgtctatccagggccgag
tccgtcttgcctccacctgattggtcgccggtgacaacccaaccatcttaccaaaccaac
cggctcacctttttcccttactcgaacgactctttcgaaacagataaccagttcagcgac
ggggattcacactttatcgatgaatctcacgagcttagagaaaacctcacggtgggcgat
ctcaagaaagaaccaatggctgaaaaggtgaagctgattctgggatacttaacagctgtt
aagggcgatctgaaggaacgacaaggtctggccatttctggagccatttccatggctgtg
gaagaaattaacaatgatccagatattctaccaaacgtcactctggaggtgcgatggaac
gatacaagaggagagacggttttggccactcgcgctatgactgacatgatgtgcgaagga
gtggccgcgttttttggtccagaaggttcctgttttgtggaaggcattgtttcgcaggct
cgaaatattcctatgatcagctataaatgttccgactacagagcctccaagattccaaca
tttgcgcgaacagaaccgccagatacccaggtcaccaaatccatcgtgtcgctgctaaac
tactacaattggaacaagttttcgatcatctacgaggagggttgggagacggtggccact
tcgctggaaaaacaggccgaaggcaagaacatgtcggttcaacacaagaaaaatgctgga
gaccggcacaaatgttgtctgcagaactacaagtgttgccagagcgggttttggtatgaa
attatccagaattccaaaaacaagacgcgaatttacgtttttctgggcacatcgatatcg
ttggtggatttcatggacaccatgcaaagagcgcagcttttcgaaaatggggaatacata
gtgatttatgtagacatgaacacctatctggaaaaggaagtgcacaaatacatatacaag
tttgacgaattggaaaagtacaaaaactgtaaagaattgtccgattatcccagcttggtg
actcgagttaaatcgctgtttgttgtggttcccaccgctcccactgaaaactacaagaat
ttttcggagaaagtacgcaattacaacaagatggagccgtttgattttcaaactgttttc
cctagtgaaaagggcaaaattttcatctcctttcaaaagttcgttagtatctatgcagcg
tatttgtatgactcagtgaagctgtatgcttcggctttgcaccatttactcatcgaccag
ccaatactgaacgaaaaaactatcagggaaattgcgactaatggcacgaaaatcatcgag
acgatcatccagatcaatcaaacatatcgaagtataacgggggcggtgataaaattggac
aaaaacggcgattcggaaggaaacttctctgttctggcctatagagaaacggagcagctc
tatttaggaggtagcaataattttagttgctccttttacatggcaccagtgggccagttt
taccaaaatgaaaagtctgcctatccgcaatacaaaattaacccgagtacttcaataatg
tggcctggaggcgacaagccaaatgacgaaccgagttgcggttttgataataaactttgc
cagaaaacggatactcatcgcaacagcttgatagccgcaggaatactgggtatggtgcta
ttttgtgccggagtggtcaccatgagcatctaccgaaagtggaaaattgagcaggaaatc
gaaggattgttgtggaaaattgatagggatgacattcacagttattttgagaaggataat
atttcgagtcctagtcgaatgagtttgtgtagtgtaagtgtaacatcctatgagtcgaag
ggtggtttgcaagtgtttacaaccacagctcaatatagaggcgtggtggtgcgaatcaaa
gatctggcattttctcgaaaaaaggacatttcacgggagattatgaaggaaatgaggctg
ttgcgggatttgaggcacgataacgtcaactcgtttattggtgcttgcgtccagcccacc
tcactgctactagtcacagattattgtgccaaaggaagtttatatgatattattgaaaat
gaggatattaagctggacaagatgtttattgcttcgttagtgcatgatctcgttaagggg
atgctatatttacataactcaatgctactgtgccatggcaatttaaagtcatcaaactgt
gtggtaactagtcgatgggtcttgcaagtcacggactttggcctgggcgaattacgccaa
ctagctgcaatggaaagcgaagaggagcatcaaacttacagaaatttgctctggaaagcg
cctgagctgttgaggtttccagagaaatttatcaaaggcacaccgcaaggtgatgtttac
gcatttggcttgatattgtacgagatattagggcgaagggccccttttggagacgtggac
gatgaactaaaagacattgtgctatcaataaaaaacccaaaagaaggccagcctctaatg
agaccggacgcagacattcttcataatcctgaaatcggctgtgatgaatacgtgttagaa
gtaatgaaagaatgctggtcggaaagtccggaatgtcggccagactttcctagtattagg
tctagacttaagagaatgaaggacggaaagagcaaaaacataatggatcaaatgatggac
atgatggaaacatatgcgactaacttggaggaattggtctacgaacggactagattgctc
tatgaggaaaagaataaaactgaagacttattgcatagaatgcttccagagcctgtagct
gacaaacttaccaaaggctacggcatcgaacctgaatcattcgacttagtaacgatttat
ttcagcgacatagtaggttttactgccatgtcagctgagagcacacccttacaagtagtt
aactttctcaatgatctctacacagtatttgaccgaattattaagggctacgacgtctac
aaggtggaaacaatcggtgacgcctacatggtggtatcagggttgcccatcagaaatgga
gatcgacatgcaggcgaaatcgcctccatggcattagatctcctttcggctgttagaaat
cattccatagcccacagaccaaacgaaacactcaagcttagaataggaatacatacaggt
ccagtagtagcgggagtagtaggactgaccatgccgcgatactgtttatttggggacacc
gtaaacacggcatccagaatggaaagcaacggagaaccgttgaagatccacataagcatg
caatgcaaggacgccctggaaaaactgggaggttacactatagaggaaaggggcctggtg
agcatgaaagggaaaggcgaagtggaaacgttttggctggtgggagccaccgaacaggcc
atccagaggaaggaggtggatttgaccgaattgcctcccccgttattctgcagaccgagg
cgaagccctaaactcaacaacgaatcgaggcaaccatctattattggaggatttggagga
ttgaacagcagaagacattcgagtgttcccagaggtaccagcatagaactggaaagctcg
tccaccctgcaaaattacagtccaatggtgcagtcgcgccattttcttaaagttaaccgc
aacaatttgcatgttccagacccaggagggtccaaattgacgattaataccaccttcgga
agccaaattctcgagaaaccagaagagggtcgacaaaagcctcggcctcgaagagtgttg
tctagcattgcgtctagctcggaggaaccgcacaagagttatggaggattgaataaggtg
cgcgaatcgaagtctttggatccattgccgtttgttgcaagaccagccactacggccaag
gatctgatcgattcgttcctcaccggcaggaaacgttcaacgaaaagcttagacaactgt
gataaatgcggcgaaattcagataatagcaataccgaaagacaagatggtgaacaacaat
ttcccgaatggcaatttactcaacatgccccaagaggaacagcacgggtttattgaagac
gcgcaagtgcctctgttgaagcctccaaaggtgcaaaatcctctaatagtgcgacgaaga
ggtggcagtgatgttaacaagtttcttgtcagcgattgttcgaaggcgaaactaacgcat
tccttggacgctctcccaaccaccgagaatcaactggcgccaaaaagttccttcactaaa
tggttagtgggcatatttagtggcaacagcttgaaatccagtaacgcgtcccttaaaaag
ggcgtcttgaatgattacagcattcaagcacccgacaatgaaagcatggtttag

DBGET integrated database retrieval system