KEGG   Dendroctonus ponderosae (mountain pine beetle): 109535487Help
Entry
109535487         CDS       T04899                                 

Definition
(RefSeq) pseudouridine-5'-phosphatase-like
  KO
K17623  pseudouridine 5'-phosphatase [EC:3.1.3.96]
Organism
dpa  Dendroctonus ponderosae (mountain pine beetle)
Brite
KEGG Orthology (KO) [BR:dpa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dpa01009]
    109535487
Enzymes [BR:dpa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.96  pseudouridine 5'-phosphatase
     109535487
Protein phosphatases and associated proteins [BR:dpa01009]
 HAD phosphatases
  Other HAD phosphatases
   109535487
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like Put_Phosphatase HAD Hydrolase_6
Motif
Other DBs
NCBI-GeneID: 109535487
NCBI-ProteinID: XP_019756961
Position
Unknown
AA seq 228 aa AA seqDB search
MQFKPVTHVIFDMDGLIIESESAYKRILSSIAKQFGKEFTPEVELKILGTTEKDTAKIFL
SELDISLSREEFLDLYHKQITVELQNPPLMPGVEKLIKHFAKHKVPIAVATSSSTQALSI
KTKNHQHIFKLFHHIVCGTTDLDVKNGKPAPDIFLVCASRFPENPDPSKCLVLEDAPNGI
KGAVSAGMQAVLVPAATLEEERRKSATLVVDSLEHFRPEQFGLPAFEL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgcagttcaaacccgtaacccatgttattttcgacatggacggactgataatcgagtcc
gaatcggcctataagcggattttgagttcaattgctaagcagtttggtaaagaatttacc
cctgaagtggaactgaaaatattgggcaccactgagaaagatacagccaaaatttttctg
tccgagctagatatatcattatcgcgagaggaatttttggacttgtatcacaaacagatc
acagtggaattgcagaatccgcctttaatgccaggtgtagaaaaattgattaaacacttt
gcaaagcataaggttcctatagcagtagccacatcgtcttccacacaggctttgtccata
aaaaccaaaaatcatcaacatattttcaagttatttcaccacatcgtatgcggaaccact
gatttggacgtgaagaacggcaaacctgctcctgatatttttttggtttgcgcttcacga
tttcccgaaaatcccgatccttccaagtgccttgtgttagaagatgcgcccaatggcata
aaaggggctgtgtcggctggtatgcaagctgttcttgttccggctgccactctcgaagaa
gagcgcagaaaatctgctactttagtggtcgattcactagaacactttagacctgaacag
tttggtctacctgcctttgaactatag

DBGET integrated database retrieval system