KEGG   Dendroctonus ponderosae (mountain pine beetle): 109537992Help
Entry
109537992         CDS       T04899                                 

Definition
(RefSeq) MAP kinase-activated protein kinase 2
  KO
K04443  mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
dpa  Dendroctonus ponderosae (mountain pine beetle)
Brite
KEGG Orthology (KO) [BR:dpa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dpa01001]
    109537992
Enzymes [BR:dpa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109537992
Protein kinases [BR:dpa01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   109537992
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo
Motif
Other DBs
NCBI-GeneID: 109537992
NCBI-ProteinID: XP_019760571
Position
Unknown
AA seq 359 aa AA seqDB search
MNPLNSVRNFSPKKNAITEDYEITKQVLGLGISGKVVECFNKNTKEKFALKVLSESEKAK
REVTLHWRASGCRHIVNIIDVYENKLQNKICLFVVMECMEGGELFQRIQDKAEGTAFTER
EAAQVMNEICVAVKYLHDLDIAHRDLKPENLLYSKKGTYGVLKLTDFGFAKETINKDTLQ
TPCYTPYYVAPEVLGPEKYDKSCDIWSLGVIMYILLCGYPPFYSDHGLAISPGMKKRIRT
GQYSFPDLEWQKVSDAAKKLINGMLNVDPVKRLSIDDVIHNSWIAQYTAVPQTPLHTHRM
LKEGEEMWSEVQEEMTRSLATMRVDYDQVQMKPLDKSNNSLLNKRRKKVAGMSTSPKKV
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgaatcctttaaactctgtgagaaacttttctcccaagaaaaacgctatcactgaggac
tacgaaataacaaaacaagtattgggccttggaattagtggaaaagttgtagaatgcttc
aacaaaaacactaaagaaaaatttgctttaaaggtactgtctgaaagtgagaaggccaaa
agggaagtcacattacattggagagctagtggttgtcgacatattgttaatatcattgat
gtttatgaaaataaattgcagaacaagatctgcctttttgttgtcatggagtgcatggaa
ggaggcgaactatttcaaagaattcaagacaaggcggaaggaactgcatttacagaaaga
gaagccgcacaagtcatgaatgaaatctgcgtggctgtaaaatatttacatgatctagat
attgcccatagagacttaaagccggaaaaccttctatattccaaaaaaggtacttatggt
gtacttaagttaactgattttggattcgccaaagagactattaataaagacaccttacaa
actccttgttacaccccttattatgttgctcctgaagtattgggaccagaaaagtatgac
aaaagctgtgatatttggtctctaggtgtcattatgtatattttattgtgtggatatccg
ccattttatagcgaccatggattggctatttcaccaggtatgaaaaagcgcattagaacc
ggccaatacagttttccagatcttgagtggcagaaagttagtgatgctgctaaaaaactt
attaatggaatgctaaacgtcgatcctgttaagagattgtcaatcgatgatgttatacac
aacagctggattgcgcaatacacagcagtgccacaaactccactgcatactcatagaatg
ctaaaagaaggagaggaaatgtggtccgaagtacaagaagaaatgactagatctcttgct
acaatgcgcgttgattatgatcaagttcaaatgaaaccactagataagtctaataattca
ttactaaacaaacgtcgcaaaaaagtcgctggtatgtcaacaagtcccaaaaaagtttag

DBGET integrated database retrieval system