KEGG   Dendroctonus ponderosae (mountain pine beetle): 109538059Help
Entry
109538059         CDS       T04899                                 

Definition
(RefSeq) heat shock protein 68-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
dpa  Dendroctonus ponderosae (mountain pine beetle)
Pathway
dpa03040  Spliceosome
dpa04141  Protein processing in endoplasmic reticulum
dpa04144  Endocytosis
dpa04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:dpa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    109538059
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    109538059
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109538059
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    109538059
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dpa01009]
    109538059
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:dpa03041]
    109538059
   03009 Ribosome biogenesis [BR:dpa03009]
    109538059
   03110 Chaperones and folding catalysts [BR:dpa03110]
    109538059
   04131 Membrane trafficking [BR:dpa04131]
    109538059
   03051 Proteasome [BR:dpa03051]
    109538059
   03029 Mitochondrial biogenesis [BR:dpa03029]
    109538059
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dpa04147]
    109538059
Protein phosphatases and associated proteins [BR:dpa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     109538059
Spliceosome [BR:dpa03041]
 Complex B
  Other components
   Prp19 complex
    109538059
 Complex C
   Prp19-CDC5 complex
    109538059
Ribosome biogenesis [BR:dpa03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    109538059
Chaperones and folding catalysts [BR:dpa03110]
 Heat shock proteins
  HSP70 / DNAK
   109538059
Membrane trafficking [BR:dpa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    109538059
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    109538059
Proteasome [BR:dpa03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    109538059
Mitochondrial biogenesis [BR:dpa03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    109538059
Exosome [BR:dpa04147]
 Exosomal proteins
  Proteins found in most exosomes
   109538059
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C BcrAD_BadFG Hydantoinase_A StbA DUF3153
Motif
Other DBs
NCBI-GeneID: 109538059
NCBI-ProteinID: XP_019760660
UniProt: J3JWS1
Position
Unknown
AA seq 639 aa AA seqDB search
MVKKSPAVGIDLGTTYSCVGVWQHGKVEIIANDQGNRTTPSYVAFTDTERLLGDAAKNQV
AMNPSNTVFDAKRLIGRKFDDPKIQQDIKHWPFKVVNDHGKPKLQVEHKGETKTFAPEEI
SSMVLTKMKETAEAYLGTTVKDAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAA
ALAYGLDKNLKGEKNVLIFDLGGGTFDVSILTIDEGSLFEVKSTAGDTHLGGEDFDNRLV
NHFADEFLRKFKKDLRSNPRAIRRLRTAAERAKRTLSSSTEATLEIDALFEGVDFYTKIS
RARFEELNSDLFRGTLQPVEKALKDAKMDKGSVDDIVLVGGSTRIPKIQQLLQNFFSGKP
LNLSINPDEAVAYGAAVQAAVLNGETDSKIQDVLLVDVAPLSLGIETAGGVMTKIIERNS
RIPCKQTQTFTTYSDNQPAVTIQVFEGERAMTKDNNLLGTFDLTGIPPAPRGVPKIEVTF
DMDANGILNVSAKDNSSGRERNITIKNDKGRLSQADIDRMLSEADRYKDEDEKQRQKVAA
RNSLESYIFQVKQAAQECGDKLSSDDKATVERECSEALKWLDSNTLAEKEEFEDKQKELQ
RLCSPIMSKLYGGGAQAPHGGFPGGPQQANGGPKVEEVD
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaaaaatctcctgcagtgggtattgatttgggtaccacatattcgtgtgttggt
gtctggcaacatggaaaagtggaaatcatcgccaacgaccaaggaaaccgcacaaccccc
agttatgttgcttttacagacaccgagcgtctacttggagacgccgcaaagaaccaagtt
gccatgaacccatctaacactgtcttcgacgcaaaacgactaattggacgcaaattcgat
gatcccaagatccaacaagatatcaaacattggccgtttaaagtcgtcaacgaccatgga
aaaccaaaactccaagtcgaacacaagggcgaaactaaaacgttcgcacctgaagaaatc
agctccatggttttaacgaaaatgaaggaaactgcagaggcgtatcttggaacaactgta
aaagatgctgttgttaccgttccagcctacttcaacgattcccaaaggcaagccactaaa
gacgctggagtgattgctggtctaaatgtaatgagaattattaacgaacctaccgcagct
gcccttgcttatggcctggacaagaatctaaagggcgaaaagaacgtcctgattttcgat
cttggaggcggaactttcgatgtgtccatcctaactattgatgaaggttcactattcgag
gtaaaatcgacggcaggcgacacccatcttggaggtgaagacttcgacaaccgtctagtc
aatcacttcgccgatgaatttttgagaaaattcaaaaaagacctccgcagcaacccaaga
gcaattagaagattgagaacagcagctgagcgggcaaaacgaactttgtcctccagcacc
gaagccactctggaaattgatgctctattcgaaggggtggacttctacactaaaatctcc
cgagccagattcgaagaattgaattccgatctgttcagaggaactttacagccggttgaa
aaggcacttaaggatgccaaaatggataaaggctctgtggatgacattgttctagtggga
ggctctaccaggattccgaaaattcaacagctgctgcaaaacttctttagcggcaaaccg
ttaaacctcagcatcaaccctgatgaggctgtagcctatggggctgccgtgcaagctgca
gttttgaatggagaaactgactcgaagattcaggatgtgttgcttgtagatgtagcgccg
ctgtctttgggtattgaaacagccggaggcgtaatgacgaagatcatcgaaagaaattcg
agaattccatgcaagcagacccagacgttcaccacctactccgacaaccaaccggctgta
accattcaagtatttgagggcgaaagagccatgaccaaagacaacaatctcttgggcacg
ttcgacctaactggcattcctccggcccctcgtggtgttcctaaaatcgaagttaccttc
gatatggacgctaatggcatcctaaatgtttctgcgaaagataacagttcaggcagagaa
agaaacatcaccatcaagaatgataagggccgactatctcaagccgatatcgacaggatg
ctttctgaggccgaccgatacaaggacgaagatgaaaaacagaggcaaaaagtggctgca
cgcaactctttggaatcctacatcttccaagtcaagcaagctgctcaagagtgtggcgat
aaattaagctcagacgataaagcaacagttgaacgggagtgttctgaagccctcaaatgg
ctggacagcaacactttggcggaaaaagaggagtttgaagacaagcagaaggagttgcag
aggttatgcagcccaattatgagcaaactgtatggaggaggagcgcaagctccacatgga
ggtttcccaggaggaccgcaacaggctaatggagggcctaaagtagaagaggttgattaa

DBGET integrated database retrieval system