KEGG   Dendroctonus ponderosae (mountain pine beetle): 109538720Help
Entry
109538720         CDS       T04899                                 

Definition
(RefSeq) aromatic-L-amino-acid decarboxylase-like
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
dpa  Dendroctonus ponderosae (mountain pine beetle)
Pathway
dpa00350  Tyrosine metabolism
dpa00360  Phenylalanine metabolism
dpa00380  Tryptophan metabolism
dpa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    109538720
   00360 Phenylalanine metabolism
    109538720
   00380 Tryptophan metabolism
    109538720
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dpa04147]
    109538720
Enzymes [BR:dpa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     109538720
    4.1.1.105  L-tryptophan decarboxylase
     109538720
Exosome [BR:dpa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109538720
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_1_2 Aminotran_5 SepSecS PAX DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-GeneID: 109538720
NCBI-ProteinID: XP_019761650
Position
Unknown
AA seq 492 aa AA seqDB search
MHSVEDSGSKMNIQEFKDFACASIDYIADYCENIRNFPVLPSVAPGYLSRALPKCAPEKG
EHWNHIMEDLDRNIIPGLTHWHSPYFHAFFPTGQSYPAIIGELFMAGIGAVATKWDSSPA
VVELEVIVMDWLAKILGLPEEFLNCSEGPGGGLIQNAASESTLVGILSASHKKIQQFRIE
NPLMDEWEIRGKLVAYTSKESNSSVEKAGLIASVKMRLLPTDENGSLRGSVLEEAIRSDK
INGLVPFCVVASLGTTGVCSMDNIAELGKICESEKMWLHIDAAYAGTALSCPEYRHLING
IEHVDSFNFNPHKWMLTNGDCSALWFRNTTYVELAFKTKAALSVPQFQPELEHRQIPDVR
RFRALKLWFVIRIYGVEGIQQHVRRHIALANYMEELVSGDSRFSVVVSNLGVVCFRLLGD
ESVTQLILERIAMKKCIYIMPYYYKKQLLFRFVVCSRFSTRADIQKSWDEIVNATNEVLI
TIANSKDPVSTV
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgcattcggtcgaagatagtggcagcaagatgaacatacaagaattcaaagattttgca
tgtgcatccattgattatattgcggattactgtgaaaatattagaaattttccagttctg
cctagtgtggctcctggttatttgagtcgcgctctgcctaaatgcgccccagaaaaagga
gaacactggaaccacataatggaagatctggatagaaatataatacctggattaacacac
tggcactctccgtattttcacgccttttttccaactggacaatcctacccagctataatt
ggagaacttttcatggctggcatcggagccgttgcaacaaaatgggattctagtcctgca
gttgtagaactggaagtaatagtgatggattggcttgcaaaaatattgggattaccggag
gaatttctcaattgttctgagggtcctggtggaggtctcatacagaatgctgcaagtgaa
tcaacgttggtgggaattctgtcagcaagccacaaaaaaattcaacagttccgaattgag
aatcctctaatggacgaatgggaaattagaggcaaattagtagcgtacacctccaaggag
tcaaattcatcggttgagaaagctggtctaatagcttcagtgaaaatgaggttgttgcca
acagatgaaaatgggagcttgaggggatccgtcttagaagaagccatcaggagtgataaa
ataaacggtttagtaccgttttgcgtggtggcatctttagggactactggagtgtgttca
atggacaacattgcagaactcggaaagatatgcgagagcgagaaaatgtggttgcacatt
gatgctgcgtatgctggcacagcattatcttgtccggaatacagacatctgatcaatgga
atagaacacgtggattcgttcaactttaacccacataaatggatgttgaccaatggagat
tgctcggcattgtggtttagaaacacaacatatgttgagttagcttttaagaccaaagct
gcgctaagcgttccgcagttccagccagaattagaacataggcaaattccagatgtaaga
agatttagagctctgaagttatggtttgtgatcaggatatacggagtagaaggcatccaa
cagcacgtgcgtcgccacatagctttggctaactatatggaggagctggtcagtggcgac
tcaagattctcggttgttgtatcaaacttaggtgtggtgtgcttccgattacttggagac
gaatctgttacgcaattgattttagagcgcatagctatgaaaaaatgcatttatattatg
ccttactactacaaaaagcagctattatttaggtttgtagtgtgtagcagattctcaact
cgagcggatattcaaaaatcgtgggacgaaatcgtgaatgcaacgaatgaggtcctaata
actattgcaaatagtaaagacccagtttcaactgtgtaa

DBGET integrated database retrieval system