KEGG   Dendroctonus ponderosae (mountain pine beetle): 109539501Help
Entry
109539501         CDS       T04899                                 

Definition
(RefSeq) protein IWS1 homolog
  KO
K17498  transcription factor SPN1
Organism
dpa  Dendroctonus ponderosae (mountain pine beetle)
Brite
KEGG Orthology (KO) [BR:dpa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:dpa03021]
    109539501
Transcription machinery [BR:dpa03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     109539501
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Med26
Motif
Other DBs
NCBI-GeneID: 109539501
NCBI-ProteinID: XP_019762840
Position
Unknown
AA seq 675 aa AA seqDB search
MEVETEESDLNMSKSPKSPARSRSASIASNRSSKSRSVSPKTNQNGTSSPRQSRSRSRSA
ASNRSRSRSGSARSAASNRSRSRSAASNSRSRSRSRSAGSRKSKSRSRSGSANSAASKRS
RRSKSKSRSRSRSRSGSAKSGASNRSGKSRSRSKSVASNGSRKSKSRSRSRSGSAKSAAS
SRSRRSKSRSRSRSAGSTSSRKSRSRSGSARSRSRSRSGSGRSRSRSGSRRSRSRSGSRR
SRSGSRRSRSGSAKSKSRSRSRSASAASRAGSGKSRSRSGSRKSRSRSVSRKSRSRSKSG
SGDEAGPSSQMKRLLDSDSEDEERAHKSKVSKVLDSDNEENEAGPSQEPEPQENVNVDAP
AGQTQADDDYDSDDGLNPCTQSSEGMSDFDVMLQRKKEEQSKRRKRKDIDIINDNDDIIA
QLLSDMRHAAXEDRRLNQEHKPAIKKIAMLGKVMSQLKKHDLQLAFIEHNVLNVLTDWLA
PMPDRSMPSLQVRESILKLLAEFPPIDQQTLKQSGIGKAVMYLYKHPKEIKENREKAGRL
ISEWARPIFNLSTDFKALSKEERLQRDIEQMGTKRRKTEEQSEKERKELAKALNADGKPL
RPGEKGWVARARVPVPSSKDYLVRPKWKSEVDISRQTKKGMNRFEKHYKNFLDGKRLKQT
RRAVDISIEGRHMAL
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atggaagttgaaacagaggagtcagacttgaacatgtccaaatcgcccaagtctcctgcc
agatcacgatcggcctccatcgcctccaatcgctcttcaaaaagccgatccgtgtcccca
aaaaccaaccaaaatggaacttcgtcgccccgccaatcccgatcacgcagcagatcagct
gctagcaatcgctcaagatccagaagcggctcagcgcgtagcgcagccagcaaccggtcc
cgatctcgcagcgctgcttctaacagccgatctagatcgaggagcagatccgctggcagc
agaaagtcgaaatcgcgctcccgtagcggatcggcaaacagcgcagccagcaagcgaagc
agaaggtccaagagcaagtccaggtccagatcgaggtcgcgcagcggatcggccaagagt
ggcgcaagcaatagaagcgggaagtccagatccagaagcaagagtgtggccagcaacggt
agcaggaagtcgaaaagccggtctcggtcgcgcagcggctcagcaaagagcgcagctagt
agccggagtaggagatcaaagtccagatcacgaagccgttcagccggaagcacgtcgagc
agaaaatctagatcgagaagcggttcggccaggagcaggtccaggtctagatcgggatca
ggcagatcgaggtcaagatcagggtctagacgctcgagatcacgatcgggatctcgccgc
tcaaggtcaggatcaagaagatctcggtctgggtcggcaaaatccaaatcgcgatcaaga
tccagatcggcttctgccgcatctcgtgcaggatctgggaagtctcggtcacgctctgga
tccaggaaatctaggtcacgctcagtttctcgcaaatctcggtccagatcaaagtcagga
tcaggagatgaagcaggcccgagcagccaaatgaaaagattgttggattcggattcagaa
gatgaggaaagagcgcacaagtccaaggttagcaaagtactggacagcgataatgaggag
aacgaggccggaccgtctcaggagccagagccacaagaaaatgttaatgttgatgcacca
gcgggtcaaacgcaagccgatgatgattatgattcggatgacggactcaatccatgcacc
caaagtagcgaaggaatgtccgattttgacgtgatgctccagcggaagaaggaggagcaa
tctaaacgacgaaaacggaaggatatagatatcatcaacgacaacgacgatatcattgcc
cagctattgtcagatatgcgacatgctgcnnaggaggacagaaggctgaatcaggagcac
aagccggccataaagaaaattgccatgctaggcaaggtcatgtctcaactcaaaaaacac
gacctacaattggccttcattgagcacaacgtacttaatgtgctcactgattggctggcg
ccgatgcccgaccgctccatgccctcccttcaagtgagagagagcattctgaagctactt
gcggaatttcctccaatcgaccagcaaaccctcaaacaatcaggcataggaaaggctgta
atgtacctgtacaaacaccccaaggaaataaaggagaacagagaaaaagctggaagacta
atcagcgaatgggcgcgaccaatcttcaatttatccacagatttcaaagctcttagcaaa
gaggagcgtctacagcgggacatagagcagatgggcaccaaacggcgcaaaaccgaggaa
caatccgaaaaagagcgaaaagagttggctaaagccctcaatgccgatggaaagcctcta
cgaccaggagagaagggttgggttgctcgtgctcgagtgccagtgccgtcaagcaaggac
tatctagtcaggcccaaatggaaatctgaagtagatataagtagacaaaccaagaaaggg
atgaatcgttttgagaagcactacaagaacttcctggatggcaaacggttgaagcaaacc
agaagggccgtcgatatttctatagaaggacgacacatggccctttga

DBGET integrated database retrieval system