KEGG   Dendroctonus ponderosae (mountain pine beetle): 109540491Help
Entry
109540491         CDS       T04899                                 

Definition
(RefSeq) methionine--tRNA ligase, cytoplasmic
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
dpa  Dendroctonus ponderosae (mountain pine beetle)
Pathway
dpa00450  Selenocompound metabolism
dpa00970  Aminoacyl-tRNA biosynthesis
dpa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    109540491
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    109540491
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:dpa01007]
    109540491
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dpa03016]
    109540491
Enzymes [BR:dpa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     109540491
Amino acid related enzymes [BR:dpa01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   109540491
Transfer RNA biogenesis [BR:dpa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    109540491
 Prokaryotic type
   Other AARSs
    109540491
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g WHEP-TRS tRNA-synt_1 GST_C_3 GST_C_6 GST_C_2 GST_C Anticodon_1 GST_N_5
Motif
Other DBs
NCBI-GeneID: 109540491
NCBI-ProteinID: XP_019764461
UniProt: N6TAC6
Position
Unknown
AA seq 930 aa AA seqDB search
MGTIEGNENNPATLKLVLAGKLAKTQYAVKIRGHNEEGQYLPYLALSSEDNIFVPNAAIW
FILPPAEELSAKVREVLEMESTVLSPSLALLLGTNLKSEKVKSSVLSALQSLNSTLEGSQ
FLVQDAITVADVAVFSTLFPIFKAAKLLKEYLGSFPSISKYLNQLELLPEVKDSVAIVFH
QKCNIGPVSYQVLFQSSKYLVPQIQSDPKTVNRVDSVEKESPKHEVETVSSEELEAAEKA
WKKSPGSLPKLKTPNKVVLPKTGEKNVFITSALPYVNNVPHLGNIIGCVLSADVFARFSR
LCNNNTLYICGTDEYGTATETKALEEGLSCQAICDKYFKIHQEIYQWFNISFDSFGRTST
PLQTELAQDLFLQLNHNGFMSTQAVDQLLCEKCNRYLADRFVEGGCPNVGCTYEDARGDQ
CDGCGKLVNAIELKNPRCKICGSTPKVKSSSQFFIDLPKLEPLLLHWVKNSSPGWSHNAE
VIAKAWLKEGLKPRCITRDLHWGVPVPLDGFRNKVFYVWFDAPIGYMSISKAYTKEYEKW
WRPAKDTEVKLYQFMAKDNVPFHAILFPAILLGANREYVTVSHIMATEYLNYEEGKFSKS
RGIGVFGNDARDTKIPSDVWRFYLLYVRPEAQDASFSWNDLATKNNSELLNNLGNFINRA
LIFVKNNFNSTIPKLELTSEDYTLLALCTRELKGYIAALDKCKLRDGIRHILAISRHGNQ
YMQLNQPWVKIKQGEEGKLRGGTVVGVCANLSCLLATLLQPYLPETSEKLKAQLNCEYFV
LNPENIEIINLLPTGHSIGEPQPLFTKIEPEVIEEYKKKFAGSQESRKTPPKEIVKPDLC
NGDAETLEEAIAKQGLVVRKLKEGGFDKTVWAPEVAKLVALKARLAELTGVVPDKKSSSK
KSNATTNNNVQKVANNMPAKSKKKPVNNSN
NT seq 2793 nt NT seq  +upstreamnt  +downstreamnt
atgggtacaatagaaggcaatgaaaataatccagcaactctcaaactagtcctggcaggc
aaactggcaaaaactcaatatgcagtgaaaattcgagggcataatgaggaaggtcaatat
ttgccatatttagctcttagttcggaagacaatatttttgtaccgaatgcagcaatatgg
ttcattttgccaccggctgaagagctttcagccaaagtaagggaagtgctggagatggaa
tccactgtcttatcaccttctttagccctgcttcttggaactaacttaaagtctgaaaaa
gtaaaaagttctgtattatcagccttgcaatcgctcaattcaaccttagaaggaagtcag
tttcttgttcaagacgcaataaccgtagcagatgtagcagtattttccacgttatttcca
atttttaaagctgcgaaactccttaaggaatatctaggaagctttccttcaattagcaaa
tatctcaatcagctagaactactacctgaagtcaaggattccgtcgcgatagtttttcat
caaaaatgcaacattggccctgtttcctaccaagtgctgttccaaagctcgaagtatttg
gtacctcagatccagtctgacccgaaaacggtcaacagagtggattcagttgagaaagaa
tcgccaaaacatgaggtggaaactgttagcagtgaagagctggaagcagcagagaaggcg
tggaaaaaatctcccggctcactccctaagctgaaaaccccaaataaagtcgtattgcca
aagactggcgagaagaacgtttttataacttccgctttgccctacgtaaataacgtaccc
catctaggaaatatcattggttgcgtgttgtctgccgacgtttttgcacgtttttctcgc
ctatgcaacaacaacactttgtatatttgcggcactgatgagtacggaactgccaccgaa
accaaagccctagaggaaggcttatcatgccaggctatatgcgataaatacttcaagatt
caccaggagatctatcagtggttcaatatcagctttgatagctttggtcggacgtctaca
cctttgcaaactgagttggcccaagatcttttcttgcaactgaaccacaatggattcatg
tccactcaggctgttgatcagctactttgcgagaaatgtaaccgctacttggccgaccga
tttgttgaaggcggctgtccgaatgtgggctgcacttatgaagatgctcgcggcgatcaa
tgtgatggttgcggcaaactggtcaatgccattgagctgaagaatcccaggtgtaaaata
tgtggtagcactcccaaagtgaagtcttctagtcaattctttatcgatttgcccaaactg
gagcctttgctgcttcactgggtgaaaaactctagccctggttggtcgcataatgctgag
gtaattgcaaaggcctggctgaaggagggcttgaagcccaggtgtattaccagggatctt
cattggggcgtgcctgtgcctttagatgggtttcgcaataaggtattctacgtctggttt
gatgcgccaattggctacatgtcaatcagcaaagcctacactaaggagtacgaaaaatgg
tggcggcctgctaaggacacggaagtaaaactctatcaatttatggccaaagacaatgtt
cccttccatgccattctattccctgcaattttacttggtgctaacagggaatatgttacg
gtgtctcatattatggccacagagtacttaaactatgaagaggggaagttctccaaatcg
cgcggaattggggtgtttggtaatgacgcaagagatacaaaaatcccgagtgatgtttgg
aggttttacctcctgtatgttcggccggaggcccaagatgcgagcttcagttggaacgac
ttggccaccaagaataactctgaattgcttaataacttgggcaattttatcaatagggca
ttgattttcgtgaaaaacaacttcaacagcactatccccaaattggaactcaccagcgaa
gactacactctcttggcgttgtgcactcgggagctcaaaggctacattgcggccttagac
aaatgcaagttgagagacggcattcgacacatcttggcgatttccagacacggaaaccag
tacatgcagctgaaccagccgtgggtaaaaatcaaacaaggcgaagagggaaagttgcga
ggcggaacagttgtgggagtttgtgcaaatctatcctgccttttggctaccttattgcag
ccctacttgcccgaaaccagtgagaaactcaaagctcaattgaactgcgaatactttgtg
ctgaatcccgaaaatattgaaataatcaacctgttgcctactggacactcaattggcgag
ccgcagccactgtttacgaaaatcgaacctgaggtgatcgaagagtacaagaaaaagttc
gctggtagccaagaatcgagaaaaactccgcccaaagaaattgtgaaaccagatttgtgc
aatggggatgcggaaactctcgaggaagcgattgcaaaacagggattggttgtgagaaag
ctgaaagagggcgggtttgacaaaacggtgtgggctccggaggtcgcaaagctagtggcg
cttaaagcccgcctggccgaactaacaggcgttgttccggacaaaaaaagctcttcaaag
aaatccaatgctacaacgaataataatgtgcaaaaagtagccaacaacatgccggcaaaa
tcaaaaaagaagccggttaacaacagcaattga

DBGET integrated database retrieval system