KEGG   Dendroctonus ponderosae (mountain pine beetle): 109540902Help
Entry
109540902         CDS       T04899                                 

Definition
(RefSeq) tripeptidyl-peptidase 2
  KO
K01280  tripeptidyl-peptidase II [EC:3.4.14.10]
Organism
dpa  Dendroctonus ponderosae (mountain pine beetle)
Brite
KEGG Orthology (KO) [BR:dpa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dpa01002]
    109540902
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:dpa03110]
    109540902
Enzymes [BR:dpa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.10  tripeptidyl-peptidase II
     109540902
Peptidases and inhibitors [BR:dpa01002]
 Serine peptidases
  Family S8: subtilisin family
   109540902
Chaperones and folding catalysts [BR:dpa03110]
 Intramolecular chaperones
  Subtilisin family
   109540902
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPPII Peptidase_S8 TPPII_N
Motif
Other DBs
NCBI-GeneID: 109540902
NCBI-ProteinID: XP_019764986
UniProt: N6U0I7
Position
Unknown
AA seq 1263 aa AA seqDB search
MQNELPVDTEFPVWGLLPKRETGVVSFLSKYPSYDGKGIIIAILDSGVDPGAPGLQETSD
GKPKIIERFDCSGCGDVNTSTLVSAEDGYITGLTGRKMKIPSNWNNPSETYRIGVKNAFD
LYPDRLKERVKSEYKKKKWEEGQRKLISDLNRDLSNLETSQNSNSSNENEKHEKEDCEAK
LDVLNNLDKKYYDSGPVYDCILFNDGSKWMCCINTSADNELANCPVLGEYSVTHEYLPLT
KLDSLNFSFNVHDNGNVLELVGVCSSHGTHVASIASAYFANAPEQNGIAPGAQVISLTIG
DGRLGSMETGTGLIRAMIKILELKQKMDVHVINMSYGEHAHWVDAGRIGDLVNEIVNKYG
IIWVSSAGNNGPALGTISTPSDIDDEPIISVGAYVSPEMMVAEYAMKQKLSGAPYTWSSR
GPTVEGGVGVHICAPGGAITSVPNFTLRYSQLMNGTSMASPSCAGAICLLLSGIIQENCY
YSPYLVRRALMNTANFIAGVEIPAQGAGLIQVDKAFDYLIAYQSIRERNVRFQLQCGSSS
TKGIYLRTKTNSKKHIFKVSVEPRFLNEDEVSAEEKINFNMKLALTCPLECVQYPKHLDL
SNVARTFGIDIDTSALPEGLHSTFVSAYDTACVSKGPVFQIPVTIIQPSEVPDQKFILKY
SSIPFKPNTIKRHYFVVPSAATWAVLKLTSNEDSGRFVIHTMQSLPRQHCKSLETVKIVA
VTSKTDTYVSFQVKGDIVLEVVIAKYWANTGEATLEYSIAFYGVKPNQPLINMHSADGIH
TVEVKTLQGEEISPTISLKNSVQILKPSEGKITPLTDRDVIPPNRQIYELVLVYNFSISK
PCEVSPNLSLLSHMLYESEYESQLWMLFDANKQLLSSGDAYPSKYTVKLEKGEYTIRLQV
RHDKRDYLEKITDASLLLQQKLASSIVMDVYLTYSQALIGGKKAGVTYNANPHTIVPFYI
APLASDKFSIKSNNMAHYLSGTITYAKDEIGKKVDVYPIKYFLSDNSSPKKTGSNGGGAP
VLDKSKKDEYNDALRDLSINWISKLDKEGGEKLYCELLKNHPNNLPIHSSYLQMLDPLDK
RILPALRKKPSVTADDLNKIANTCDKVLNSLNEETILASMAVKTDLRVDAVKVKIQAEQQ
KNIYLECLARKGIALSRLSLLDESGDNQHQEIANVWKSLVKFVDPSDAKILTSHVLFFAI
WHAFVNQHYGRLLKFMFKMQEDKSSEELERRIIDICQELKWKHVVEYLERGLPSKFPNSY
RPF
NT seq 3792 nt NT seq  +upstreamnt  +downstreamnt
atgcagaacgagttacctgtggacacggaattccctgtatggggcttactacctaaaagg
gagacaggagtggtctcatttttatctaaatacccatcatatgatggtaaaggtattatt
attgcaatcctggattcgggcgtcgaccctggggcacccggtttgcaggaaacttctgat
ggaaaacctaaaataatagaaagatttgactgcagtggttgtggagatgttaatactagc
acgcttgtatcagctgaagatgggtacattacgggtcttactggaagaaaaatgaagatt
ccaagtaattggaacaatccctccgaaacatatagaattggtgtaaaaaatgcttttgat
ttatatcctgatcggttgaaggaacgcgtaaagtcagaatataagaagaaaaagtgggaa
gaaggccagaggaaattaatcagtgacctgaatcgtgatctatctaatttagagacttca
cagaacagcaatagttccaatgagaatgaaaagcacgaaaaagaagattgtgaagctaaa
ttagatgtattgaataatcttgacaagaaatattatgattctgggccagtatatgattgc
attcttttcaatgatggttcaaaatggatgtgctgcattaatacaagtgcagataatgaa
ttagcgaattgtcctgtcttaggagagtatagtgttactcatgaatatttgccattaacg
aaattggatagtctcaactttagctttaatgttcatgataatggaaatgtgctcgagtta
gtaggagtgtgttctagtcatggcacacatgtagcttcaatagcctctgcttatttcgcc
aatgcaccagaacaaaacggcattgcaccaggcgcccaagtaatatcactcactattgga
gatggcaggttaggctcgatggagacaggcaccggattaattagagctatgattaagatt
cttgagctaaagcaaaaaatggatgtccatgttattaatatgagttacggagaacacgcg
cattgggtggatgcagggcgtattggagatttagtgaatgaaattgtcaataaatatgga
ataatatgggtgtcatctgctggtaacaatgggccagcattaggtactatcagcactcct
tcagatatagatgacgaacctataatcagtgttggcgcctacgtatctcctgaaatgatg
gtggcggaatatgccatgaagcaaaagctgtcaggagctccatacacgtggtcttctaga
ggtccaactgttgaaggtggtgtaggagttcatatatgcgctccgggcggtgcaattacc
tcagttcccaattttacattgcgctattcgcaacttatgaatggcacctctatggcttct
ccaagttgcgctggcgcaatttgtcttcttctctcaggcataattcaagaaaattgttac
tattctccatatttggtccgaagagccttaatgaatactgccaatttcatagcaggtgtt
gaaattccagctcaaggagcgggactaatacaagtcgataaagctttcgattatcttatc
gcttatcaaagcattcgcgaaaggaacgtgcgtttccagttgcagtgtggttcaagcagt
accaagggaatttacctacgtaccaaaacgaacagcaaaaagcacatttttaaagttagt
gttgaacctcggtttttgaatgaagatgaagtttcagcagaggaaaagatcaattttaac
atgaagctggctttgacatgtccactagaatgtgttcaatatccaaagcatttagatctg
tctaatgttgcgagaacgtttgggattgatatagacacatctgcattaccagagggactg
cattcaacttttgtcagtgcttatgatacagcatgcgttagtaaaggtccagtatttcaa
attcctgtcacaataattcagccaagtgaagttcctgaccaaaagttcattcttaaatat
agtagtattccatttaagcccaacacaatcaagaggcattattttgttgtaccgtcagca
gcaacgtgggccgtattaaagctgacttcgaatgaggacagtggacgtttcgtcatacat
acaatgcagtcgcttcccaggcagcattgtaagtctttggaaacagtgaaaattgtggct
gtgacttcaaagactgacacgtacgttagtttccaagttaaaggggacatcgttttagaa
gtagtcattgctaaatattgggcaaatactggtgaagcgacattggaatatagcattgcc
ttctatggcgtcaaacctaatcagccactaatcaacatgcatagtgccgacggtatacat
acagtagaagttaaaaccctacagggtgaagagatttctccaaccatttcattgaaaaat
tccgtgcaaatattgaagccttcagaaggaaaaattacccctctcactgatcgtgatgtt
attcctcctaaccgacaaatctacgaactagtactggtttataatttcagtatttcaaag
ccttgcgaagtatcacccaatctatctttgcttagtcatatgctctatgaatctgagtac
gagtcgcaactttggatgctatttgatgcaaacaagcagcttttaagtagtggtgatgct
tatccctctaagtataccgtgaaacttgagaaaggcgaatatacgatacgattacaagta
aggcacgacaaaagggattacttggaaaaaattacagatgcttctttactattgcaacaa
aaattggctagtagcatagtgatggatgtctatttgacttactcccaagcccttatcgga
ggaaagaaagctggggttacctacaacgccaatccacatacgattgttccattctatatc
gccccattggcttctgataaattttctattaaatcaaacaatatggctcattatctctcc
ggaaccataacatatgctaaagatgaaattggtaagaaagtcgacgtttatccaatcaaa
tactttttatcagacaatagtagtcctaaaaaaaccggttcaaatggtgggggagctcca
gtgctagataaatccaagaaagacgagtataatgatgctttgagagatttgagcattaat
tggatttctaaactagataaagaaggaggcgagaaattgtactgcgaattactgaaaaat
catccaaacaatttgccaattcattcctcctatttgcaaatgcttgatcctctagacaag
agaatattgccagctttacggaaaaagccatctgttactgctgatgatttaaacaaaatc
gccaatacgtgcgacaaagtgctaaatagcctaaatgaagaaacgatattggcttctatg
gctgttaaaacggatttgcgagtcgatgctgttaaggtcaaaatacaagcagagcagcaa
aagaatatttatctggagtgtttggcacggaaagggatagctttgtctcggttaagtttg
ttagacgaaagcggtgataatcagcatcaggaaatagcaaacgtatggaaatcactcgta
aaatttgttgatcctagtgatgcaaagattctaacatctcatgtattgttttttgcaatt
tggcatgcgtttgtgaatcaacactatggaagacttttaaaattcatgtttaaaatgcaa
gaagataagtccagtgaggagctggaaaggagaattatagatatatgtcaggaattaaaa
tggaaacatgtggtcgaatatttagagagaggactaccttcaaagtttcccaattcgtat
agaccattttag

DBGET integrated database retrieval system