KEGG   Dendroctonus ponderosae (mountain pine beetle): 109541031Help
Entry
109541031         CDS       T04899                                 

Definition
(RefSeq) dual specificity protein phosphatase 10-like
  KO
K20216  dual specificity phosphatase 10 [EC:3.1.3.16 3.1.3.48]
Organism
dpa  Dendroctonus ponderosae (mountain pine beetle)
Pathway
dpa04013  MAPK signaling pathway - fly
dpa04214  Apoptosis - fly
Brite
KEGG Orthology (KO) [BR:dpa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    109541031
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    109541031
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dpa01009]
    109541031
Enzymes [BR:dpa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     109541031
    3.1.3.48  protein-tyrosine-phosphatase
     109541031
Protein phosphatases and associated proteins [BR:dpa01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   MAPK phosphatases
    109541031
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc Rhodanese Y_phosphatase PTPlike_phytase Init_tRNA_PT CDKN3
Motif
Other DBs
NCBI-GeneID: 109541031
NCBI-ProteinID: XP_019765261
Position
Unknown
AA seq 400 aa AA seqDB search
MSVCLDSSRSRNGLKLPLNRSFSEPGPPTPLSHLHPTKRSKLEPQNSISLPTSPCAESAT
VQRLHVLNNVKTLEPEALKAKLEDHRPGKNFILLDCRPFMSYNMNHISGAINLNCSDRFN
RRRLQQGKVSLADLATTREGKEVLKKRSFKEVIIYDDSTTGKDRITLGHPLLLVMVSLVE
DQKEPSLLIGGHREFHKKHKEFCEHTLTQSLTSRGISPSASCPSLADVDSYPASKVLPFL
YLGNSKDAADLSCLEGLGTTCVLNVTSQLPGYHEERGITYKQIPATDSGHQNLKQYFEEA
FEFIEQARLNGSRVLVHCQAGISRSATIAIAYIMKYKQMSMWEAYKKVKEVRPIISPNLN
FMGQLLELEQSLRTDNNTNNNLQCRWSQQSTDEVTQGCSV
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtgtgcctcgacagcagtcgatcgagaaacggcttaaagcttcctctgaacaga
agctttagtgaaccaggcccgcctacccccctcagtcatctacaccctacgaaaagatcc
aaactggagccccaaaacagcatcagcttacccacgagtccctgtgcagaatcagcgaca
gtgcaacgccttcatgttcttaacaatgttaaaactctggaacctgaagcgcttaaggct
aagctcgaggaccacagacctggaaaaaacttcatccttctagactgccgacccttcatg
agctacaacatgaatcatatcagtggcgcaatcaacctgaactgttcggatcggtttaat
agaagaaggctgcaacaagggaaagtcagtcttgctgatcttgccaccaccagagaaggc
aaagaggtgctcaagaaacgttccttcaaggaggtcattatttacgatgattccaccacc
ggaaaagacaggataactctgggacatcccttacttttggtcatggtttctctagtggag
gaccagaaggaaccgtcactgttaattggaggccaccgggaatttcacaaaaagcacaaa
gaattttgtgaacatacactcacacaaagccttacgtctcggggcatttcgccctcagca
tcttgccctagtttagccgatgtagactcataccccgcatcgaaagtcttaccttttttg
tatttgggtaatagtaaggatgcagccgacctttcttgtctagaaggacttggtaccacc
tgcgtattgaacgtgacgtcgcaactgcccgggtaccacgaagaacgcggtatcacatac
aaacaaataccggcgaccgactcaggccaccagaacctgaagcagtattttgaagaagct
ttcgaatttatcgaacaagcacgactaaatggttcacgagtcctggttcattgtcaagcg
ggcatatcaagaagtgccacaatagcaattgcctacataatgaaatacaagcaaatgtcg
atgtgggaagcatacaagaaagttaaggaagtgcggccgatcatttcgccaaacctcaac
tttatgggtcaactattagaattagaacagagtttacgcactgacaacaacaccaataac
aatctgcaatgccgatggagtcaacaatccacggatgaagtgacgcagggctgtagtgta
tga

DBGET integrated database retrieval system