KEGG   Dendroctonus ponderosae (mountain pine beetle): 109542365Help
Entry
109542365         CDS       T04899                                 

Definition
(RefSeq) venom acid phosphatase Acph-1-like isoform X1
  KO
K19283  prostatic aicd phosphatase [EC:3.1.3.2 3.1.3.5]
Organism
dpa  Dendroctonus ponderosae (mountain pine beetle)
Brite
KEGG Orthology (KO) [BR:dpa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    109542365
Enzymes [BR:dpa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.2  acid phosphatase
     109542365
    3.1.3.5  5'-nucleotidase
     109542365
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 DUF2534
Motif
Other DBs
NCBI-GeneID: 109542365
NCBI-ProteinID: XP_019767126
Position
Unknown
AA seq 376 aa AA seqDB search
MFVMDILWIGSVLFIITISEAVPIRESTANETTLKLVHVIFRHGDRNPGKSQLYPSNAYY
DEMHYYPYGYGQLTNNGKIRVYELGEIIRKRYNNFLGSQWNMNVLDIRSTDYNRTKMSAQ
LMTAGLWPPRRINIWNPVFRWQPIPYNYERAENDELLSPWLACSTVNTLISALLESTELG
NYMSERYNETLHILSENTGLEMSYLQAFRLYLGFSIQDELNMPLEEWTSSVYPEPLHSFV
IDYYHIRTNTTELKKIISGYLIKQIIENTENQINGTLTPNGRKMFIYSGHEANIATLLLS
LQATKVVDVPPYGSFIIIETHKIDAVYGIKLYYQDYKNDDPQELQITGCDKFCPFDDFVT
LFTDILPTSTSECYGV
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgtttgttatggatatattatggattggttctgtattgtttatcataacgatttctgaa
gctgtaccaatccgagaatcaactgccaacgaaacgacgttaaaattagttcatgtgata
tttaggcatggtgacagaaacccaggaaaatcgcaactatacccaagtaatgcatattac
gatgagatgcactattatccttatggatatggacagttaacaaataatggtaaaatccgt
gtgtacgaactaggggaaataattcgaaaacggtacaacaatttcttaggcagtcaatgg
aacatgaacgtcttagacatcagaagtaccgattacaacagaacaaaaatgtctgcgcaa
ctaatgacagccggattgtggcctccaagaagaattaatatatggaatccagtttttcgt
tggcaacctataccttataattatgaaagagctgaaaatgacgagctattgtcaccttgg
ttggcgtgttccaccgttaacactctaatatctgccttattggaaagcactgaactgggg
aattatatgtctgaacgttacaatgagacactacatattttatctgaaaacacggggttg
gaaatgagttacctgcaagcgtttcgtctatatctgggattttcaattcaggacgaacta
aatatgcctttagaagaatggacatcgtcggtttatcctgaaccattacattcttttgtt
atcgattattaccacatccgaacaaatacaactgaactgaaaaaaattatttctggctac
ttgataaagcaaattatcgaaaatacagaaaaccaaattaacggaacactaacaccaaat
ggaagaaaaatgtttatttattcaggacacgaagcaaatattgctacattgttactttcg
ttgcaagcaaccaaagttgtggacgttcctccttacggatcgtttattatcattgaaact
cataagatagatgctgtgtatggaattaagttgtattatcaagattataaaaatgacgac
cctcaagaactacaaattacaggatgtgataaattttgcccatttgatgacttcgtcact
ttatttactgatatattaccaacctcgaccagtgaatgctatggtgtgtag

DBGET integrated database retrieval system