KEGG   Dendroctonus ponderosae (mountain pine beetle): 109542540Help
Entry
109542540         CDS       T04899                                 

Definition
(RefSeq) probable pseudouridine-5'-phosphatase isoform X1
  KO
K17623  pseudouridine 5'-phosphatase [EC:3.1.3.96]
Organism
dpa  Dendroctonus ponderosae (mountain pine beetle)
Brite
KEGG Orthology (KO) [BR:dpa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dpa01009]
    109542540
Enzymes [BR:dpa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.96  pseudouridine 5'-phosphatase
     109542540
Protein phosphatases and associated proteins [BR:dpa01009]
 HAD phosphatases
  Other HAD phosphatases
   109542540
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAD_2 Hydrolase HAD Hydrolase_like Acid_PPase
Motif
Other DBs
NCBI-GeneID: 109542540
NCBI-ProteinID: XP_019767364
Position
Unknown
AA seq 304 aa AA seqDB search
MHPHCCNGSGKYKPVTHVIFDLDGTIIGKIIIQSFPYNMGTGFIIIADSESVYAKALQQT
IEDYGCEFYPDFITKVQGSVEKQVGRIAIETFNLDTTLEEFIKLYNFHSNKYLGDLELMP
GAERMITHLHNHNVPIAVASSTNREAFELKTNKYQQLFACFHHIVCGGTDPEVKNGKPAP
DIFLIAASRFDNPPEPAKCLVFEDSKNGMLAAVAAGMQVVMLPEPQISYDIWKLATLRLD
SFNYMLPEIFGLPPFSQEDTALVFADAKVTLTEPIQVLLDPEEKKESGKRVVLDESSLIS
NDQN
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgcatccacactgttgcaatggttccggcaagtacaaaccagttactcacgttatattc
gatctggatggaaccatcataggcaagatcataatccagagttttccttacaatatgggc
acgggttttataataattgcagattccgaaagtgtttacgctaaagctttgcaacaaact
attgaagattatggatgcgaattctatccagattttatcaccaaagtgcagggttctgta
gaaaagcaagttggccggatcgcaattgagacgttcaatctggatacgacgctcgaggaa
tttattaaactatacaattttcattcgaataaatatctgggcgacttggagctaatgcca
ggagcggaaagaatgataacccatctgcacaaccacaacgttccgatagcagtggcatct
tctacaaaccgggaagctttcgagctaaaaacgaataaataccagcaactattcgcttgt
tttcaccacattgtctgcggtggaaccgatccagaagtaaaaaatggaaaaccggcgcct
gatatctttctaatagcggcatcaaggttcgataatcctccagagccggccaaatgtttg
gttttcgaagattcaaagaatggaatgctggccgcagtggctgcaggaatgcaggtggtt
atgttgccagaaccgcagatttcttacgacatttggaagttggccactttgcggctggat
tccttcaattacatgctccctgagatatttggtctgcctcctttctctcaagaggacaca
gctttggtatttgcagatgctaaagttactctaacggaacctattcaagttttgcttgat
ccagaggagaaaaaggagagtggcaaacgtgtggtattggatgagtcgtctttgataagc
aacgatcagaattaa

DBGET integrated database retrieval system