KEGG   Dendroctonus ponderosae (mountain pine beetle): 109543459Help
Entry
109543459         CDS       T04899                                 

Definition
(RefSeq) ATP-dependent RNA helicase DHX8
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
dpa  Dendroctonus ponderosae (mountain pine beetle)
Pathway
dpa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:dpa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    109543459
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:dpa03041]
    109543459
Enzymes [BR:dpa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     109543459
Spliceosome [BR:dpa03041]
 Complex C
  Other components
   Step II factors
    109543459
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C DEAD
Motif
Other DBs
NCBI-GeneID: 109543459
NCBI-ProteinID: XP_019768749
Position
Unknown
AA seq 715 aa AA seqDB search
MDEVDKLEYLSLVSKVCTELENHLGMNDKDLAEFIIHLSESNNTTESFKRALLENGAEFS
DSFIANLLRIIQHMRVKKGQPVAGAPLKETLACKFPGLALPNEPQKPLSEPEKDSAVVAD
LMAQFEAEAPSASHRPPVERKRQRYQFKFSFFRANPALKHLNLLHFDFFDCTSPETIIKY
MTDGMLLRECLMDLDLKGYAVVMLDEAHERTIHTDVLFGLLKQAVTKRPELKLIVTSATL
DAVKFSQYFFEAPIFTIPGRTFPVEVLYTKEPETDYLDASLITVMQIHLREPPGDILLFL
TGQEEIDTACEILYERMKSLGPEVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATN
IAETSLTIDGIFYVVDPGFVKQKVYNSKTGMDSLVVTPISQAQAKQRAGRAGRTGPGKCY
RLYTERAYRDEMLPTPVPEIQRTNLATTVLQLKTMGINDLLHFDFMDAPPVESLIMALEQ
LHSLSALDDEGLLTRLGRRMAEFPLEPNLSKMLIMSVALQCSDEILTIVSMLSVQNVFYR
PKDKQALADQKKAKFNQPEGDHLTLLAVYNSWKNNKFSNAWCYENFVQIRTLKRAQDVRK
QLLGIMDRHKLDVVSAERNTVRVQKAICSGFFRNAAKKDPQEGYRTLVDSQVVYIHPSSA
LFNRQPEWVIYHELVCTTKEYMREVTTIDPKWLVEFAPAFFKFSDPTKLSKFKKN
NT seq 2147 nt NT seq  +upstreamnt  +downstreamnt
atggacgaagtcgacaaactagagtacctctcgctggtgtccaaggtgtgcaccgagctg
gagaaccatctgggcatgaacgacaaggacttggccgaattcatcatccacctgtccgag
agcaacaacacgaccgagtcgttcaagcgcgccctgctggaaaacggggccgaattctcg
gactccttcatcgcgaacttgctgcgcatcatccagcacatgcgagtgaagaagggccag
ccggtcgcgggcgcccccttgaaggagacgctggcgtgcaaattcccgggcctggcgctg
cccaacgagccccaaaagccgctgagcgagccggagaaggacagcgcggtggtggccgat
ctcatggcccagttcgaggccgaagccccatcggccagccaccggcctccagtcgagcgc
aagcggcaaaggtaccagtttaagtttagtttttttcgagcaaacccggctttaaaacac
ttaaatttgctgcattttgacttttttgactgcaccagcccggaaaccatcatcaagtac
atgacggacgggatgctgctgcgcgagtgcctgatggatctggacctaaaaggctacgcc
gtggtgatgctggacgaggcgcacgagcgcaccatccataccgacgtgctcttcggcctg
ctgaagcaggccgtcaccaagcggcccgagctcaagctgatcgtcacctccgccacgctg
gacgccgtcaagttctcccagtacttcttcgaggcgcccatcttcaccatcccagggcgc
accttcccggtggaggtcctctacaccaaggagccggagacggactacctggacgccagc
ctgatcacagtgatgcagatccacctgcgcgagccgcccggcgacatcctgctgttcctc
accgggcaggaggagatcgacaccgcctgcgagatcctctacgagcgcatgaagtcgctg
gggccggaggtgcccgagctgatcattctgcccgtctactcggcgctgccctccgaaatg
cagacgcgcatcttcgacccggcgccgcccggcagccgcaaagtggtgatcgccaccaat
atagccgaaacgtcgctcacgatcgacggcatcttctacgtggtcgatcccggcttcgtc
aagcagaaggtctacaactcgaagacgggcatggactcgctggtggtcacgcccatctcg
caggcgcaggccaaacagagggcgggccgcgcaggccgcaccggccccggcaagtgctac
cgcctctacaccgagcgcgcctaccgcgacgagatgctccccactccggtgcccgagatc
cagcgcaccaatctggcaacgacggtgctccagctgaagacaatggggatcaacgatctg
ctgcacttcgactttatggacgccccgccagtcgagtcgctcatcatggccctggagcag
ctgcactcattgtccgccctggacgatgagggcctcctcaccaggctgggcagacgcatg
gccgagttcccactggagccgaacctctcgaagatgctgatcatgtcggtggcgctgcag
tgctccgacgaaatcctgaccatcgtgagcatgctgagcgtgcagaacgtcttctatcgg
ccgaaggacaagcaggcgctggccgaccagaagaaggccaagttcaatcagccggagggc
gaccatctgacgctgctcgccgtctacaacagctggaagaacaacaagttctccaacgcg
tggtgctacgagaacttcgtccagatccggacgctcaagcgggcgcaggacgtccgcaaa
cagctgctcggcatcatggacaggcacaagctggacgtggtgtccgccgagcgcaacacc
gtgcgcgtccagaaggccatttgctcggggtttttccgcaacgccgccaaaaaggacccg
caggagggctaccgcacgctggtggacagccaggtggtctacatccatccgtccagcgcc
ctcttcaatcgccagcccgaatgggtgatctaccacgagctggtgtgcaccacgaaggag
tacatgcgggaggtgaccaccatcgaccccaagtggctggtggagttcgcgcccgccttc
ttcaagttctccgacccgaccaagctgagcaagttcaagaagaacca

DBGET integrated database retrieval system