KEGG   Dendroctonus ponderosae (mountain pine beetle): 109544610Help
Entry
109544610         CDS       T04899                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
dpa  Dendroctonus ponderosae (mountain pine beetle)
Pathway
dpa00010  Glycolysis / Gluconeogenesis
dpa00562  Inositol phosphate metabolism
dpa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109544610
   00562 Inositol phosphate metabolism
    109544610
Enzymes [BR:dpa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     109544610
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     109544610
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 109544610
NCBI-ProteinID: XP_019770466
UniProt: N6T0V9
Position
Unknown
AA seq 443 aa AA seqDB search
MGVRVWCFSFGLCCLFLLTKQCPRKYPFEHYLAVRTPYRFVSNSSLHKVNYEGCIPKKVW
MLVRHGTRNPSKSNLEPINSRLPIIKNNVLNSKKVPNDFIKNRDLDLFKKWKWTVKLEDE
KKLTHEGEDEMLLMAERMQSRFPEVFENVYSNTTYKFKYTFSQRTKKSAFYFAAGLFGKK
TAKDVWFPDPIKADPILRFYKLCKKWKETVKAPVHENGEHKKFQESPTMAKVASEVTERL
GLTTKLNVSDIYTMYITCGFETAWNKRPKSPWCSPFTEENLKALEYIDDLKHYWQDGYGY
QLTYQQACPAFGDLINYFNAEAAFPKVTVYFTHSGTLLKMLAHMGLYRDQNHLTASEFGN
MANRKWKTGLIDSFGTNLAFILYECDGVKKVLTMHQENIIKLPCCPESDLCEYEKIYDFY
SESIESCDFDAMCDESHSDSDSD
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgggggtacgtgtgtggtgtttttcctttggcttgtgttgtttgtttttactaactaaa
cagtgtccaagaaaatacccttttgagcattatttagctgtgcggacaccatacagattc
gtttcaaacagcagcctacataaggtcaattatgaaggatgtattcccaagaaagtgtgg
atgttagtcagacatggaacgcggaacccaagcaaatcgaatttggaaccaatcaacagc
cgattgccaataataaaaaataatgttttgaatagtaaaaaagtccctaacgactttatc
aaaaaccgtgatcttgatttgttcaaaaaatggaagtggaccgtaaaactagaggacgaa
aaaaaattaactcatgaaggcgaagatgaaatgctgcttatggccgaaagaatgcaaagt
cgctttcctgaagtattcgaaaatgtttatagtaacacaacgtataagttcaagtacact
ttttcgcaacgaaccaagaaaagtgccttttattttgcggcgggattgtttggcaaaaaa
acagccaaagatgtctggtttccagacccgataaaagccgacccaattttgagattttac
aaactttgtaagaaatggaaggaaacggttaaggctcccgtacacgaaaatggggagcat
aaaaagttccaagagtcacctactatggctaaagtggctagcgaggttactgaacgactg
ggactcacaactaaattaaacgtctctgacatatacacaatgtacataacttgcggcttt
gagactgcttggaataagcgacccaaatccccgtggtgttcgccatttaccgaagaaaac
ttgaaggctctagaatatatagatgatttaaaacattactggcaggatggatatggttat
caattgacttaccaacaagcctgtccggctttcggagatctcatcaattactttaatgca
gaagcagcattccccaaagtgacggtttactttacacattctggaaccttgctaaaaatg
ctggctcatatgggtttatatcgggaccaaaaccacttaactgcctcagagtttggaaac
atggcgaataggaaatggaagaccggtctcattgactcttttggcacaaatttggctttt
atactttatgagtgcgatggggtgaaaaaagtactgactatgcaccaggaaaacatcatt
aagcttccgtgctgtccagagtcagacctgtgcgagtatgaaaaaatttatgatttctat
agtgaaagtattgaaagttgcgactttgatgcaatgtgtgatgaatcacatagtgatagt
gatagtgattag

DBGET integrated database retrieval system