KEGG   Dendroctonus ponderosae (mountain pine beetle): 109544907Help
Entry
109544907         CDS       T04899                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD12-like
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
dpa  Dendroctonus ponderosae (mountain pine beetle)
Brite
KEGG Orthology (KO) [BR:dpa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:dpa01002]
    109544907
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dpa04147]
    109544907
Enzymes [BR:dpa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     109544907
Peptidases [BR:dpa01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   109544907
Exosome [BR:dpa04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   109544907
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_1 Hydrolase_4 Abhydrolase_6 Peptidase_S9 DUF676 Abhydrolase_3 Say1_Mug180 DUF2207 Abhydrolase_2 LIDHydrolase
Motif
Other DBs
NCBI-GeneID: 109544907
NCBI-ProteinID: XP_019770890
UniProt: N6TRS2
Position
Unknown
AA seq 383 aa AA seqDB search
MGDSKCCCCCKKRRYSQDSSSPESDDNETAKERPVWQKILIWSLAVLFIILFLVFLLIWV
VVPIIFWTSISFQRFMIFYPIDSPKDPQFDDPEKYGIDNVYNTYITVRDYYDNNTLTQIG
AWLILPENLQNSPSNDVSQIIRESQYDLLVFLHGVYANRAKPIAQYKVFRKKFLVLAIDH
RGYGDSGSNVQMLEHGMINDHLQIYDWILAKNFTKNIYYWGHSLGGALSCHIVRALKERN
NAVPTGLILESTFTTLVEAIENNAVGKIYSWLAYFNATILNPLDENGFHFYSTTHILHVD
CPIMILHAEDDGMIPSALGEKLANISSVERDSATQGSVTTHIFSSDYGYGHNYITSDTNI
PQYIEDFKEVCESFTQQGPRSRD
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgggggatagtaaatgctgttgctgttgcaaaaagagaagatattcgcaggattcttca
tcgccagaaagcgatgacaatgagactgcaaaagagcgcccagtttggcagaaaattctg
atctggagcttagcagtattgtttatcatactgttcctagttttcctcttgatatgggta
gttgttccaataatcttttggacatccatatcattccaaagattcatgattttctaccca
atcgattctccaaaggatccacagtttgatgatcccgaaaaatatggtatagataatgtg
tacaacacatacataacagtcagagactattacgacaataatacactcacccaaatagga
gcatggcttattttacctgaaaacctgcaaaattccccctcaaacgacgtttcgcaaatt
atccgagaatcccagtacgatcttctagtgtttcttcatggggtttacgcgaatcgcgcc
aagccaattgctcagtacaaagtgttcaggaagaaatttttggttctggctattgaccat
cgaggctatggagattcaggttccaacgtgcaaatgctggagcatggaatgataaatgac
catctgcagatctacgactggatcctggccaagaacttcacgaaaaacatttattattgg
ggccattcactgggtggggctttgagctgccatatagtgcgggctctaaaggagcgcaat
aatgctgttcccacaggactgattttagagtccacgtttactactctagttgaagccatt
gagaataatgcagttggcaagatatacagttggctggcgtattttaatgcaactatttta
aatcctttggatgaaaatgggtttcacttctactcaaccactcatattcttcacgttgat
tgtcccatcatgattttgcatgcggaggatgatggcatgattccctcagctctgggagaa
aagcttgcaaatatctcaagcgttgaaagggattctgccacccaaggcagcgtgacgacg
cacattttttcttcggattatggttacggacacaattatataacgtctgatacgaatatt
ccccagtatattgaagacttcaaggaagtatgtgaatccttcacccagcaaggtccacga
tccagggattaa

DBGET integrated database retrieval system