KEGG   Dietzia psychralcaliphila: A6048_00850Help
Entry
A6048_00850       CDS       T05437                                 

Definition
(GenBank) cobyrinic acid a,c-diamide synthase
  KO
K02224  cobyrinic acid a,c-diamide synthase [EC:6.3.5.9 6.3.5.11]
Organism
dpc  Dietzia psychralcaliphila
Pathway
dpc00860  Porphyrin and chlorophyll metabolism
dpc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    A6048_00850
Enzymes [BR:dpc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.9  hydrogenobyrinic acid a,c-diamide synthase (glutamine-hydrolysing)
     A6048_00850
    6.3.5.11  cobyrinate a,c-diamide synthase
     A6048_00850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 Fer4_NifH MobB
Motif
Other DBs
NCBI-ProteinID: AWH94301
UniProt: A0A2T5AMH0
Position
complement(200712..202265)
Genome map
AA seq 517 aa AA seqDB search
MVTASSSGSRTELPRLIVAAPASGHGKTTVATGLMAALRRRGLTVSGHKVGPDYIDPGYH
ELATGRPGRNLDPHLVGEDRIVPLLLHGAQAAPRPADVAVIEGVMGLYDGQIGGDGFSST
AHVAGLTDTPVLLVVDISHASRSIAAVVLGMATFDPTVRIGGVILNKAGSLRHSDEVRRA
LEPLGIPVLGVLSRDDDVTAPSRHLGLVPAAERPGAASSLDHLAGRIAASVDLDAVMRLA
HAAPPLRGSAWSAEEALVGGLPDSGPPALALSGPRRPVVAVAGGRAFTFRYAETVELLHS
AGCDVAVFDPLADSALPEGTAGIYLGGGFPEVHAAGLAANRPMLTALRTALGAGVPTVAE
CAGLLYLCRTLDEAPMIGAVPADAAMSPRLTLGYRRVTARSTNLLAAAGTEVTGHEFHRT
TVTPGAGHSSAGIGGAEMSGAGMRGAWTGPERDEGFATDTLHASYLHTHWAGHPSLAARF
AAAVTRHAAGATATSVAGPRTDGDTDRMSAVVDIRSV
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggtgaccgcctcgtccagcgggtcgcgcaccgagctgccccggttgatcgtggccgcc
ccggcgtcgggtcacggcaagaccaccgtcgccaccgggctcatggcggcgctgcgccgg
aggggcctcacggtctccggccacaaggtgggaccggactacatcgaccccggctaccac
gagctcgccaccgggcggccgggccgcaatctggacccacacctggtcggcgaggacaga
atcgttcccctcctgctgcacggcgctcaggccgcgccgcgcccggccgacgtcgccgtg
atcgagggcgtgatgggcctgtacgacggccagatcgggggcgacggcttctcctccacc
gcccacgtcgccggcctcaccgacaccccggtactgctcgtggtggacatctctcacgcc
tcgcgcagcatcgcggccgtggtcctggggatggccacgttcgaccccaccgtccggatc
ggcggcgtgatcctcaacaaggccggatccctccggcactccgacgaggtccgccgggcc
ctcgagccgctggggatccccgtgctcggggtactcagtcgcgacgacgacgtcacggcg
ccgtcccgccacctcgggctggtcccggcggccgagcgaccgggggccgccagcagcctc
gaccacctcgccggccgcatcgccgcctccgtggacctggacgcggtgatgcggctcgcc
cacgcggcgccgccgctgcggggttcggcgtggtccgcggaggaggcgctggtggggggc
ctgcccgactcgggaccgccggcactggcgttgtccgggccccggcggccggtcgtcgcc
gtggcggggggacgcgccttcacgttccgctacgccgagaccgtcgagctactccacagc
gcgggctgcgacgtggcggtgttcgaccccctcgccgactccgcacttcccgagggaact
gcggggatctacctcggcggggggttccctgaggtgcacgccgcggggttggccgccaac
cggccgatgctcacggccctgcggaccgccctcggcgccggcgtgccgacggtggccgag
tgcgcgggcctgctctacctctgtcgcaccctcgacgaggccccgatgatcggtgcggtc
ccggcggacgcggcaatgtccccccggctcacgctcggctaccgtcgcgtcaccgcgcgg
agcacgaatctcctggcggcggcgggcaccgaggtcaccggccacgagttccaccgcacc
accgtcacccccggcgccggacactcctcggcgggaataggcggcgcggaaatgagcggg
gcggggatgcgcggggcgtggacgggacccgagcgcgacgagggcttcgcgaccgacacc
ctgcacgcgtcgtacctccacacccactgggccgggcacccgtcgctcgcggcgcgcttc
gcggcggcggtcacccggcacgccgccggggcgacggcgacgtccgtcgcgggaccgcgt
accgacggcgatacggaccgcatgtcggcggttgtcgacatacggtccgtatga

DBGET integrated database retrieval system