KEGG   Dietzia psychralcaliphila: A6048_04605Help
Entry
A6048_04605       CDS       T05437                                 

Definition
(GenBank) GDP-mannose pyrophosphorylase
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
dpc  Dietzia psychralcaliphila
Pathway
dpc00051  Fructose and mannose metabolism
dpc00520  Amino sugar and nucleotide sugar metabolism
dpc01100  Metabolic pathways
dpc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dpc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    A6048_04605
   00520 Amino sugar and nucleotide sugar metabolism
    A6048_04605
Enzymes [BR:dpc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     A6048_04605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Hexapep DUF4954 Hexapep_2
Motif
Other DBs
NCBI-ProteinID: AWH97209
Position
1037575..1038645
Genome map
AA seq 356 aa AA seqDB search
MADTEAVVLVGGKGTRLRPLTISAPKPMLPTAGLPFLTHLLSRIRAAGIRRVVLGTSFKA
EVFEEYFGDGSDLDLELTYVVETEPLGTGGGIRNVLDQLTASTIMVFNGDVLGGTDLTEI
LDLHHAKSADLTMHLVRVSDPRAFGCVPTDDDGRVLEFLEKTQDPPTDQINAGCYVFRRE
LIAQIPEGVPVSVERETFPQLLSEGKRVYGFVDSAYWRDMGTPEDFVRGSSDLVRGIAPS
PALEGHHGEALVHDGAGVGAGAVLIGGTVVGRGAEIGAGVRLDGAVVFDGARIEAGATVE
RSIIGAGARIGHRALIRDGVIGDGADVGARCELLRGARVWPGVVIPDGGIRYSTDM
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atcgccgacaccgaggcggtggtcctggtgggcgggaaggggacccgactgcggcccctg
accatctcggcgcccaagccgatgcttcccaccgccggtctgcccttcctcacgcacctg
ctctcgcggatccgggcggccgggatccggcgcgtggtgctgggcacctcgttcaaggcg
gaggtgttcgaggagtacttcggcgacggatccgatctcgacctggaactgacgtacgtg
gtggagaccgaacccctgggtaccggcggcggcatccgcaacgtcctggaccagctgacg
gcctcgacgatcatggtcttcaacggtgacgtgctgggcgggaccgacctcaccgagatc
ctcgacctccaccacgccaagagcgcggatctgaccatgcacctggtccgggtctccgac
ccccgcgcgttcggctgcgtgccgaccgacgacgacggacgggtcctggagttcctggag
aagacccaggacccgccgaccgaccagatcaacgccggctgctacgtcttccggcgcgag
ctgatcgcgcagatccccgagggtgtgcccgtctcggtggagcgcgagaccttcccccag
ctgctcagtgaggggaagcgggtctacggcttcgtcgactcggcctactggcgcgacatg
ggcacacccgaggacttcgtccgcgggtcctccgacctggtgcggggtatcgcgccgtcg
cccgcactcgagggccaccacggtgaggcgctcgtccacgacggcgcaggggtcggcgcc
ggggcggtactcatcggcgggacggtggtcgggcgcggcgccgagatcggtgccggtgtc
cgactggacggcgcggtggtcttcgacggcgcccggatcgaggcgggggcgacggtcgaa
cgctcgatcatcggcgccggggcccgcatcggccaccgggcgctgatccgcgacggcgtc
atcggcgacggcgccgacgtgggcgccaggtgtgagctgctgcgcggagcccgggtctgg
cccggcgtcgtgatccccgacggcgggatccgctactccacggacatgtag

DBGET integrated database retrieval system