KEGG   Dietzia psychralcaliphila: A6048_09020Help
Entry
A6048_09020       CDS       T05437                                 

Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
dpc  Dietzia psychralcaliphila
Pathway
dpc00620  Pyruvate metabolism
dpc00630  Glyoxylate and dicarboxylate metabolism
dpc01100  Metabolic pathways
dpc01110  Biosynthesis of secondary metabolites
dpc01120  Microbial metabolism in diverse environments
dpc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dpc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A6048_09020
   00630 Glyoxylate and dicarboxylate metabolism
    A6048_09020
Enzymes [BR:dpc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     A6048_09020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: AWH95619
UniProt: A0A2T5APH3
Position
1988192..1990372
Genome map
AA seq 726 aa AA seqDB search
MSERITVGGVQVDEVLYDFVNNQAIPGTGVDPDAFWAGVSEIFTDLAPRNRELLAVRDEL
QSKIDTWHHENPSPIDPAAYKAFLQEIGYLVPEPDSVRVTTENVDEEIATVAGPQLVVPI
MNARFAINAGNARWGSLYDALYGTDAIPESGGAEQGSSYNKVRGDKVIAWAREFLDDAAP
LDSGSHVGTTGYSVVDGRLQVTLADGSTTGLADSAQFVGYLGEDTTPTSVLLRNNGLHVE
IQIDADSPIGSTDSAGVKDVVLESAVSTIMDFEDSVAAVDAEDKTHGYRNWLGLMKGDLS
EEISKGDKTFTRVLNDDRVFTAPDGSGEVRLHGRSMLFVRNVGHLMTNPAVLDSEGNELP
EGILDALITSLAGMHGIAESNERGNSRTGSIYIVKPKQHGPAEVAFTTELFGRVEKLLGL
PENTLKVGIMDEERRTTVNLAACIAEATDRVVFINTGFLDRTGDEIHTSMEAGPMIRKGE
MKSARWMAAYEDFNVDTGLACGLRGRAQIGKGMWAKTDLMSEMLTEKIGQPRAGANTAWV
PSPTGATLHATHYHRVNVMSRQEELLAGGPRASVDDILSVPLAPDTDWTDAEKKEEVDNS
CQTILGYVVRWVEQGIGVSKVPDIHDVNLMEDRATLRISSQMLANWIRHGIITADDVEDS
LRRMAEIVDTQNAGDDAYRNMAPDFDSSIAWQAARELILEGTGQPSGYTEPILHRRRREF
KAANGL
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaacgcatcaccgtcggcggcgtccaggtcgacgaggtcctgtacgacttcgtc
aacaaccaggcgatcccgggcaccggggtcgatcccgacgcgttctgggcgggagtctcc
gagatcttcaccgacctggcgccgcggaaccgtgaactgctcgcggtccgcgacgagttg
cagtcgaagatcgacacctggcaccacgagaacccctccccgatcgaccccgccgcctac
aaggcgttccttcaggagatcgggtacctggtcccggaaccggactctgtccgggtgacc
accgagaacgtcgacgaggagatcgccacggtcgccggcccccagctggtcgtgccgatc
atgaacgcgcgtttcgcgatcaacgcgggcaacgcacggtgggggtcgctgtacgacgcc
ctctacggcaccgatgcgatcccggagtccggtggcgcggaacagggctcctcctacaac
aaggtccgcggggacaaggtcatcgcctgggcccgtgagttcctcgacgacgccgcgccg
ctcgactccggcagtcacgtcggcaccaccggctactccgtggtcgacggccgactgcag
gtgaccctcgccgacggttcgaccaccggtctggccgactccgcgcagttcgtcggctac
ctgggcgaggacaccaccccgacctcggtgctgctgcgcaacaacggcctgcacgtggag
atccagatcgacgccgattccccgatcgggtcgaccgactccgccggcgtcaaggacgtc
gtcctcgagtccgccgtctccaccatcatggacttcgaggactcggtcgccgccgtcgac
gccgaggacaagacccacggctaccgcaactggctgggtctcatgaagggcgacctctcc
gaggagatcagcaagggcgacaagaccttcacccgcgtcctcaacgacgacagggtcttc
accgcgcccgacggttccggagaggtccgtctccacggccgctcgatgctcttcgtccgc
aacgtgggccatctgatgaccaaccccgcagttctcgactccgagggcaacgaactgccc
gagggcatcttggacgccctgatcacctcgctggccggcatgcacggaatcgccgagagc
aacgagcgcggcaacagccgcaccggttccatctacatcgtcaagcccaagcagcacggc
ccggccgaggtggccttcaccaccgagctgttcggccgtgtcgagaagctcctgggtctg
cctgagaacactctcaaggtgggcatcatggacgaggagcggcgcaccacggtcaacctc
gccgcctgtatcgccgaggccaccgaccgggtcgtgttcatcaacaccggcttcctcgac
cggaccggggacgagatccacacctcgatggaggccggaccgatgatccgcaagggcgag
atgaagtccgcacgctggatggccgcctacgaggacttcaacgtcgacaccggactggcc
tgtggcctgcgtgggcgcgcccagatcggtaaggggatgtgggccaagaccgacctcatg
tccgagatgctcaccgagaagatcggacagccgagggccggcgccaacaccgcctgggtc
ccgtccccgaccggtgccaccctgcacgccacccactaccaccgggtgaacgtgatgtcc
cggcaggaggagctcctcgccggagggccccgcgccagcgtcgacgacatcctcagcgtc
cccctcgcacccgacaccgactggaccgacgccgagaagaaggaggaggtcgacaactcc
tgccagaccatcctcggctacgtcgtccgctgggtggaacagggcatcggcgtctcgaag
gtgccggacatccacgacgtcaacctgatggaggaccgcgccaccctgcggatctcctcg
cagatgctggccaactggatccgtcacggcatcatcaccgctgacgacgtcgaggactcg
ctgcgccgcatggccgagatcgtcgacacgcagaacgccggggacgacgcgtaccggaac
atggcgccggacttcgactcgtccatcgcctggcaggccgcccgcgagctgatcctggag
ggaaccggacagccgtcgggctacaccgagccgatcctgcaccgccgccgccgcgagttc
aaggcggccaacggcctgtag

DBGET integrated database retrieval system