KEGG   Dietzia psychralcaliphila: A6048_10070Help
Entry
A6048_10070       CDS       T05437                                 

Definition
(GenBank) methyltransferase type 11
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
dpc  Dietzia psychralcaliphila
Brite
KEGG Orthology (KO) [BR:dpc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:dpc03009]
    A6048_10070
Enzymes [BR:dpc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     A6048_10070
Ribosome biogenesis [BR:dpc03009]
 Prokaryotic Type
  rRNA modification factors
   23S rRNA modification factors
    A6048_10070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AWH97350
Position
complement(2219326..2220162)
Genome map
AA seq 278 aa AA seqDB search
MGSTDTGVECGGGHSFDRARGGHLTLLGSRGRRFPGDSAEQLAARERVLSHGLFDGVADA
LVGVATDAVGVAERPVVLDAGAGTGFYLDRVIGALRPPSPAGGDATDGPGEPLGIGTELS
VAAARRLARVNPLVTALVVDTWDGLPLVDECVDLVQVVFAPRNPSEFARVLRKGGTLVVA
VPGPGHLEPLRTQAGMLAPAADKAERLDTHLAAGFEPGPVRVVDVTATVPAAIAADLALM
GPSGVHLDRAGVEQVVGTVDSPVRVHVEVRSFRRSLQE
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
ttggggtccaccgacaccggcgtggagtgcggcggcgggcattcgttcgatcgtgcacgc
ggtggccacctgaccctgctcggttcgcgtgggcgccggtttccgggggactcagccgag
cagctcgccgcccgcgagagggttctcagccacgggctgttcgacggggtagccgacgcc
ctggtgggggtggcgaccgacgcggtcggcgtcgccgagcgacccgtggtcctggacgcc
ggggccggcacgggtttctatctggaccgtgtcatcggcgcgctgcgcccgccgtccccg
gcgggtggggacgccaccgacggccccggggaaccgctcgggataggtacggagctctcc
gtggccgccgcacgtcggctggctcgcgtgaaccccctcgtcacggcgctggtcgtcgat
acctgggacggtctacccctggtggacgagtgcgtcgacctggtccaggtggttttcgca
ccgaggaacccgtccgagttcgcgcgcgtgctgcgcaagggcgggaccctggtcgtcgcg
gtccccggtcccggtcatctcgaacccctccggacgcaggccgggatgctcgcacccgcg
gcggacaaggccgaacggctggacacccacctggcggcggggttcgaacccggcccggtc
cgggtggtcgacgtcaccgccacggtcccggccgcgatcgcggcggacctcgcgctcatg
gggccaagtggtgtccacctggaccgggccggggtcgagcaggtcgtcgggacggtcgac
agcccggttcgtgtgcacgtcgaggtgcggtccttccgcaggtctctacaggagtga

DBGET integrated database retrieval system