KEGG   Dietzia psychralcaliphila: A6048_10645Help
Entry
A6048_10645       CDS       T05437                                 

Definition
(GenBank) isoprenyl transferase
  KO
K12503  short-chain Z-isoprenyl diphosphate synthase [EC:2.5.1.68]
Organism
dpc  Dietzia psychralcaliphila
Pathway
dpc00900  Terpenoid backbone biosynthesis
dpc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dpc00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A6048_10645
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:dpc01006]
    A6048_10645
Enzymes [BR:dpc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.68  (2Z,6E)-farnesyl diphosphate synthase
     A6048_10645
Prenyltransferases [BR:dpc01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   A6048_10645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Prenyltransf
Motif
Other DBs
NCBI-ProteinID: AWH95894
Position
complement(2335022..2335789)
Genome map
AA seq 255 aa AA seqDB search
MDASSPLYSLYESRLRSSLEGARLPRHIAVMADGNRRWAKEAGFADVAHGHRAGAVKIAE
MLGWCDELGVDVATIYLLSTENLGRDAEELDELLQIIADVVDEITGPDKNWDVRIVGRLE
VLPDWLAERLRHAERASTGRRGVKVNVAVGYGGRQEIADATRELVAQLIDEGRTGRELVD
GITVEAIGEHLYTSGQPDPDLVIRTSGEQRLSGFLLWQSAYSEIWFTEAYWPAFRRVDFL
RALRDYGARNRRFGH
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
gtggatgcctcctcccccctgtactcgctgtacgagtcgcgactccgatcgtcgctcgag
ggtgcccggctcccacggcatatcgcggtgatggccgacggcaaccgtcgttgggccaag
gaggccgggttcgcggacgtggcgcacgggcaccgggccggggcggtcaagatcgccgag
atgctgggctggtgcgacgagctgggcgtggacgtggccaccatctatctgctcagtaca
gagaacctcggtcgcgatgcagaggagctggacgagctgctgcagatcatcgccgacgtg
gtggacgagatcaccggcccggacaagaactgggacgtccggatagtcgggcggctcgag
gtgctgccggactggctggcggaacggctccgccacgccgagcgcgcgagcaccgggcgt
cggggggtcaaggtcaatgtcgccgtgggctacggaggccggcaggagatcgccgacgcg
acccgcgagctcgtcgcccagctgatcgacgagggccggaccgggcgcgaactggtcgac
ggcatcaccgtggaggccatcggcgagcacctctacacctccggccagcccgatcccgac
ctggtgatccgtacctccggcgagcagcggctctccggcttcctgctgtggcagagcgcg
tattccgagatctggttcaccgaggcgtactggcccgcgttccgccgcgtggacttcctc
cgcgcactgcgtgactacggtgcccgcaaccgcaggttcggccactga

DBGET integrated database retrieval system