KEGG   Dietzia psychralcaliphila: A6048_11945Help
Entry
A6048_11945       CDS       T05437                                 

Definition
(GenBank) succinyl-CoA--3-ketoacid-CoA transferase
  KO
K01028  3-oxoacid CoA-transferase subunit A [EC:2.8.3.5]
Organism
dpc  Dietzia psychralcaliphila
Pathway
dpc00072  Synthesis and degradation of ketone bodies
dpc00280  Valine, leucine and isoleucine degradation
dpc00650  Butanoate metabolism
dpc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    A6048_11945
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    A6048_11945
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A6048_11945
Enzymes [BR:dpc01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     A6048_11945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans
Motif
Other DBs
NCBI-ProteinID: AWH96088
UniProt: A0A2T5AVV0
Position
complement(2628688..2629464)
Genome map
AA seq 258 aa AA seqDB search
MSSKIMTAAEAVADIPDGASIAAGGFGLCGIPQVVIEALAARDVGDFEVFSNNAGVDGKG
LGMLLESGKLRRIVSSYVGENKEFARQYLSGELEVELTPQGTLAERMRAGGSGIGAFYTR
TGVGTYVADGGMPWKYDSDGGVALASPPKETREIRGETYVLEQAIEADFSLVRAAVADRS
GNLRFNLTARNFSPLAAMAGRVCIVEAEKIVEVGELAPDDIHLPGIFVHRLVELTPQQVE
QTKWIEKTTTNPPSEGQR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcaagatcatgaccgcggcggaggccgtcgcggatatcccggacggggcgtcg
atcgccgccggcgggttcggactgtgcgggatcccgcaggtcgtcatcgaggccctcgcg
gcccgcgacgtcggggacttcgaggtgttctccaacaacgccggtgtcgacggcaagggc
ctcggcatgctcctcgagtccggaaagctccggcgcatcgtctcgtcgtacgtgggcgag
aacaaggagttcgcgcgccagtacttgtccggtgagctcgaggtggagctcacgccgcag
ggcaccctcgccgagcggatgcgcgccggcggctccgggatcggggcgttctacacgcgc
accggtgtcggtacctacgtcgccgacggcgggatgccgtggaagtacgactccgacggt
ggcgtcgcactggcctcaccccccaaggagacccgggagatccgcggcgagacctacgtg
ctcgagcaggccatcgaggccgacttctcgctggtgcgtgccgcggtcgccgaccgcagc
ggcaatctgcggttcaacctcaccgcccgcaacttctcgccgctggccgccatggccggc
cgcgtgtgcatcgtcgaggcggagaagatcgtcgaggtcggcgagctggcccccgacgac
atccacctgcccggcatcttcgtgcaccgcctggtcgaactcacgccgcagcaggtggag
cagaccaagtggatcgagaagaccaccaccaacccgccctcggaaggacagcgctga

DBGET integrated database retrieval system