KEGG   Dietzia psychralcaliphila: A6048_12885Help
Entry
A6048_12885       CDS       T05437                                 

Definition
(GenBank) geranylgeranyl pyrophosphate synthase
  KO
K13787  geranylgeranyl diphosphate synthase, type I [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
dpc  Dietzia psychralcaliphila
Pathway
dpc00900  Terpenoid backbone biosynthesis
dpc01100  Metabolic pathways
dpc01110  Biosynthesis of secondary metabolites
Module
dpc_M00364  C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:dpc00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A6048_12885
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:dpc01006]
    A6048_12885
Enzymes [BR:dpc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     A6048_12885
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     A6048_12885
    2.5.1.29  geranylgeranyl diphosphate synthase
     A6048_12885
Prenyltransferases [BR:dpc01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   A6048_12885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-ProteinID: AWH96250
UniProt: A0A2T5AVC4
Position
complement(2826208..2827302)
Genome map
AA seq 364 aa AA seqDB search
MTLASVTAAQRMTSRDLPEGLGPAVDDWVADLDHTTRSGKGMRSALFDVVYTHAGGDDEA
VRAAACQALELLHEAFLVHDDVADGDDHRRGRPNLQGRTTARAADSGLPRETAAHVGMVG
GLLGGDLLLVAAMGEFARLPVSAQVLHRAMAEVERAVVASIVGEYADVHGAAHGEPTTQE
RALAIGAAKTAAYSVTLPLVLGVVLAGGPEELIPPLRETGRHLGTAYQVIDDVLGVFGDP
AVTGKSNEGDLVRRAPTVLLAFASATEEWPRIDTALGGTGFGRARAERVHPDRADSDRAD
PGRAHPDPATARSLLAECGAREHALGLAEDLVTAARAALDSPAVPHDLRGALDTHLATAL
ERTR
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgacactggcttcggtaaccgccgcccagcggatgacctctcgtgaccttcccgagggc
ctgggccccgccgtcgacgactgggtggcggacctcgaccacaccacccgatccggcaag
ggcatgcggtccgcgctgttcgacgtcgtctacacgcacgccggcggggacgacgaggcg
gtgcgcgccgcagcctgtcaggcgctcgaactcctccacgaggcgttcctcgtccacgat
gacgtggccgacggcgacgaccaccggagaggccggccgaacctgcaggggcgcaccacg
gcgcgcgccgccgactcgggtctaccccgtgagaccgctgcgcacgtcggaatggtgggg
ggactcctcggcggggacctcctgctggtggccgcgatgggggagttcgcgcgactgccc
gtgtcggctcaggtgctgcaccgcgccatggcggaggtcgagcgggcggtggtggcctcc
atcgtcggggagtacgcggacgtgcacggggcggcccacggcgagccgaccacgcaggag
cgcgcgctggcgatcggcgccgccaagaccgcggcctactccgtgaccctgccgttggtg
ctgggcgtggtgctggccggggggccggaggagttgatccccccgcttcgtgagaccggc
cgtcacctggggaccgcgtatcaggtgatcgatgacgtcctcggcgtcttcggcgacccg
gcggtgaccggcaagtccaacgagggtgatctggtgcgccgggcccccacggtgctgctc
gcgttcgcctccgccaccgaggaatggccgcgaatcgacaccgcgctcggtggtaccgga
ttcggccgtgcccgcgctgagcgtgtccacccggaccgtgctgactccgatcgtgctgac
cccggtcgtgcccacccggatccggcgaccgcgcggtcgctcctggccgagtgcggcgcc
cgagagcacgcgttggggctcgccgaggacctggtgaccgccgcccgcgccgcactggac
tccccggccgtcccgcacgaccttcggggcgcgctcgacacccacctggccaccgccctc
gagaggacccgatga

DBGET integrated database retrieval system