KEGG   Dietzia psychralcaliphila: A6048_15110Help
Entry
A6048_15110       CDS       T05437                                 

Definition
(GenBank) hydrolase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
dpc  Dietzia psychralcaliphila
Brite
KEGG Orthology (KO) [BR:dpc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    A6048_15110
Enzymes [BR:dpc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     A6048_15110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: AWH96596
UniProt: A0A2T5AR49
Position
complement(3296695..3297588)
Genome map
AA seq 297 aa AA seqDB search
MRIAAAQILSGRDPADNLRLVRDSVAEAATRGARIVVLPEATMRAFGAGRLDEIAEPLDG
PWATAVAEIARAHGVLVVVGMFTPGEGGRVRNTLLVTGPAGGSSDGGGGADGGAGGDGAD
AGDLHLGYDKIHLFDAFGFAESDTVEPGDATRVVTVDGVGIGLSVCYDIRFPGQFRALAA
AGARVTLCSASWGSGPGKVDQWRLLSRARALDATTFLVAVGQADPEAEGVQVKSGAPTGI
GHSMLVGPDGTVRDEAGPGAGLVLFEIDDDEVTDIRKKIPVLANGRITEDRAAEVVR
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcatcgccgcagcccagatcctgtccggacgcgatcccgccgacaatctccggctg
gtccgcgactccgtggccgaggccgccacccgtggggcccggatcgtggtgctgcccgag
gccaccatgcgggctttcggggccggccggctggacgagatcgccgagcccctcgacggc
ccgtgggcgaccgcggtggccgagatcgctcgggcacacggggtcctcgtcgtcgtcggc
atgttcacgcccggcgagggcggccgcgtgcgcaacacactcctggtcaccggccccgcc
gggggtagctcggacggtgggggcggcgcggacggtggggccggcggggacggcgcagac
gctggggacctccacctgggctacgacaagatccacctgttcgacgcgttcgggttcgcc
gagtccgacaccgtcgagcccggagacgccacgcgcgtggtgaccgtcgacggcgtgggg
atcgggctgagcgtctgctacgacatccgtttccccggtcagttccgtgcactcgcggcc
gccggcgcccgcgtcaccctgtgcagcgcgtcgtgggggtcgggccccggcaaggtcgac
cagtggcgactgctgtcccgggctcgcgcgctcgacgccaccacgttcctggtcgctgtc
ggccaggccgaccccgaggccgaaggtgtgcaggtcaagagtggcgccccgaccggcatc
ggccactccatgctcgtgggaccggacgggaccgtgcgcgacgaggcgggccccggagcg
gggttggtgttgttcgagatcgacgacgacgaggtgaccgacatccggaagaagatcccc
gtgctcgcgaacggcaggatcaccgaggaccgggccgcggaggtcgtacggtga

DBGET integrated database retrieval system