KEGG   Deinococcus peraridilitoris: Deipe_0954Help
Entry
Deipe_0954        CDS       T02381                                 

Definition
(GenBank) transcriptional regulator/sugar kinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
dpd  Deinococcus peraridilitoris
Pathway
dpd00010  Glycolysis / Gluconeogenesis
dpd00520  Amino sugar and nucleotide sugar metabolism
dpd01100  Metabolic pathways
dpd01110  Biosynthesis of secondary metabolites
dpd01120  Microbial metabolism in diverse environments
dpd01130  Biosynthesis of antibiotics
dpd01200  Carbon metabolism
Module
dpd_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dpd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Deipe_0954
   00520 Amino sugar and nucleotide sugar metabolism
    Deipe_0954
Enzymes [BR:dpd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Deipe_0954
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK FIST
Motif
Other DBs
NCBI-ProteinID: AFZ66522
UniProt: L0A015
Position
complement(984253..984996)
Genome map
AA seq 247 aa AA seqDB search
MSQILGIDIGGSGIKGAPVDLTSGTLIAERHRIPTPQPSTPQAVALVVRELCEHFGWRDA
VGCTFPAVIRGGVALSAANVDKSWIGTNAERVLSEASGLTVRVVNDADAAGLAEARFGAG
RGEDGVVMLLTLGTGIGSALLHGGLLVPNTELGHVELNGKELEHYASDKVREDQDLSWKK
WAERLSTSLQYLERLFSPDLFILGGGVSKKGDKFLPLLQVKTPVKLAELRNQAGIVGAAL
YAAGRER
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagattctcggcattgacatcggcggcagcggcatcaagggtgcgcccgtcgat
ctcacctccggcaccctgatcgccgagcggcaccgtattcccacgccgcaaccctccacg
ccccaggcggtcgcgcttgtggtgcgtgagctgtgtgagcatttcgggtggcgtgatgcg
gtgggctgcacgttcccggcagtcatccgtggtggtgtggcgctcagtgccgccaacgtg
gacaaaagctggattggcaccaacgccgaacgggtgctgagcgaggcaagcgggctcacc
gtgcgggtggtcaacgacgccgacgcggccggtctggccgaagcgcgctttggtgccgga
cgcggagaagacggtgtggtcatgctgctgaccctgggcaccggtatcggcagcgcgctg
ctgcatggcggcctgctcgtgccgaacaccgagctggggcacgtcgagctgaacggcaag
gaactcgagcattacgcctcggacaaggtccgcgaggatcaggacttgtcatggaagaag
tgggccgaacgactgagcaccagcttgcagtacctcgagcggctcttctcgcccgacctc
ttcattttgggcgggggggtcagcaagaaaggcgacaaattcctgccgctgctgcaggtc
aagactcccgtgaagctggccgagctgcgcaaccaggcaggcattgtcggcgccgccctg
tacgcggccgggcgcgagcgctga

DBGET integrated database retrieval system