KEGG   Deinococcus peraridilitoris: Deipe_1109Help
Entry
Deipe_1109        CDS       T02381                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
dpd  Deinococcus peraridilitoris
Pathway
dpd00220  Arginine biosynthesis
dpd00330  Arginine and proline metabolism
dpd01100  Metabolic pathways
dpd01110  Biosynthesis of secondary metabolites
dpd01130  Biosynthesis of antibiotics
dpd01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dpd00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Deipe_1109
   00330 Arginine and proline metabolism
    Deipe_1109
Enzymes [BR:dpd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Deipe_1109
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AFZ66671
UniProt: K9ZYL9
Position
1126904..1127788
Genome map
AA seq 294 aa AA seqDB search
MDIALLGIPMDLGAGRRGVDMGPSALRNARLSRTLRDIGHRVSDLGDVPVPLPETRDKHE
ESGLIFLEPILQACTAAGQQLAMLGEEVFPISMGGDHSISVGTVTGAARSQRSGLIWVDA
HTDFNTPASSPSGNIHGMPVAHLVGLGDAQLNSIGGGWHMRPEDIVMIGIRSVDRRERDL
VREQGITVYTMKEVDQLGISRIAEETLERLGSLPRLHVSFDADALDPSLAPGVGTPVPGG
LTYREAHLLMELLSESGRVTSMDIVEVNPALDHQNQTAHVMVGMAASLLGKRIL
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggatatcgctcttctcggcattcccatggacctcggcgccggtcggcgcggggtggac
atgggtcccagcgccctgcgcaacgcccggctttcccgcacgctgcgcgacatcggtcat
cgcgtcagcgacctgggcgacgttccggtacccttgcccgaaacgagggacaagcacgag
gaaagcggcctgatctttctggagccgattctgcaggcctgcaccgcggcagggcagcaa
ctcgccatgcttggagaagaagtctttcccatcagcatgggtggcgaccactcgatcagc
gtgggtacggtcaccggcgcggcacgcagccagcgcagcggcctgatctgggtcgacgcc
cacactgacttcaacacgcccgcctccagccccagcggcaacattcatggcatgcccgtg
gcgcacctcgtgggcctgggagatgcccagctcaacagcatcggtggaggctggcacatg
cggcccgaggacatcgtgatgatcggcattcgcagcgtggaccgccgtgaacgcgacctg
gtgcgtgagcagggcatcacggtctacaccatgaaagaagtcgatcagctgggcataagc
cgcatcgccgaggaaacgctggagcgcctcgggtccctcccccgcctgcacgtgtccttt
gacgccgacgccctcgatcccagcctggcgcccggcgtcggcacacctgtccctggcggg
ctgacctaccgcgaagcgcacctgctgatggaactgctctcagagagcggacgtgtcacc
tcaatggacatcgtcgaggtgaacccggcgcttgaccaccagaatcagacggcgcacgtc
atggtcggcatggcggccagcttgctggggaaacgcattctgtaa

DBGET integrated database retrieval system