KEGG   Deinococcus peraridilitoris: Deipe_1178Help
Entry
Deipe_1178        CDS       T02381                                 

Definition
(GenBank) pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
dpd  Deinococcus peraridilitoris
Pathway
dpd00010  Glycolysis / Gluconeogenesis
dpd00020  Citrate cycle (TCA cycle)
dpd00620  Pyruvate metabolism
dpd01100  Metabolic pathways
dpd01110  Biosynthesis of secondary metabolites
dpd01120  Microbial metabolism in diverse environments
dpd01130  Biosynthesis of antibiotics
dpd01200  Carbon metabolism
Module
dpd_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dpd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Deipe_1178
   00020 Citrate cycle (TCA cycle)
    Deipe_1178
   00620 Pyruvate metabolism
    Deipe_1178
Enzymes [BR:dpd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Deipe_1178
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding HlyD_3 DUF3583
Motif
Other DBs
NCBI-ProteinID: AFZ66734
UniProt: K9ZZV9
Position
complement(1196313..1197785)
Genome map
AA seq 490 aa AA seqDB search
MPREVVLPELAESVVEGEILKWLVNEGDSVALEQPIVEVMTDKVTVELPSPFAGTLQKKL
VQEGEIVAVHAAIAVIAEAGETAGAPVQAAASMATATSIPAHAGASSAQQAVQESFENPT
TAHVTLPVTAQEERSIVESGSQEDKGDDQSLFKAFASDEKLSVPTGLGRGGQSGNTAATQ
HGRVLAVPAARQLARELDVDLSQVQGSGPNGRVRVTDVHNYAMKQAQAAQPQAKAPTGSG
MPVAPVQYKTPKGYEALESRTPLRGMRRAISNQMLASHLYTVRTLTVDEANLSKLVALRE
RLKGGAEASGVKLSYLPFIFKAIATALQKYPSLNTSFDEAAQEIVQKRYYNLGMAVATDA
GLIVPVIRDVERKSVLQLAREILDLGTRARDGKLTPDEMAGSSFSVTNIGSIGALFSFPI
INVPDAAIMGIHSIVKRPVFDENDQVVPGHMMYLSLSFDHRLVDGAEAARFCKEVIRLLE
NPETLLLEAI
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
gtgccaagagaagtcgtattgcccgaactcgccgaatctgtggtggaaggcgaaatcctc
aaatggctcgtcaatgagggagacagcgtcgcgctggagcaaccgatcgtggaggtcatg
accgacaaagtcacggtggaactgccctcacccttcgcgggcaccctgcaaaagaagctg
gtgcaggaaggggagatcgtggccgtacacgccgccatcgccgtcattgccgaagcgggt
gaaactgccggcgctcccgtgcaggccgcggcgagcatggcgaccgcgacttcgattcca
gcacacgcaggcgcctctagcgcgcagcaggccgtgcaggaaagcttcgagaaccccacg
accgcccacgtcaccctgcccgtcaccgcgcaggaagaacgctcgatcgtcgagtcggga
agccaggaagacaagggtgacgaccaatcgctcttcaaggcctttgccagcgacgagaaa
ctcagcgtgcccaccgggctggggcgtggcgggcagagtggaaacaccgcggcgacgcag
cacgggcgggtgctggcggtgcccgccgcacggcagctggcccgtgaactcgatgtggac
ctctcacaggtgcagggcagtggccccaacggacgcgtgcgcgtgaccgacgtgcacaac
tacgccatgaagcaggcccaggcggcgcagccgcaggcgaaagctccgactggcagcggc
atgcccgtggcgccggtgcagtacaagacgcccaaaggctacgaggccctggaaagccgc
accccgctgcggggcatgcgccgcgccatcagcaaccagatgctggcgagccacctctac
acggtgcgtaccctcacggtggacgaggccaacctcagcaagctggtcgccctgcgcgag
cgcctgaaaggtggtgccgaagcttccggcgtgaagctgtcctacctgccctttatcttc
aaggcgattgccactgcgctgcagaagtaccccagcctcaacacgtcttttgacgaggcg
gctcaggaaatcgtgcagaagcgctattacaatctcggcatggcggtggcgaccgacgcg
ggcctgatcgtgcccgtcattcgcgatgtcgagcgcaagagcgtgctgcaactggcgcgc
gagattctcgatctcggcacccgcgcgcgcgacggcaagctgacgcccgacgagatggcg
ggcagctcgttcagcgttaccaacatcggctcgatcggggcactcttcagtttcccgatc
atcaatgtgccagacgcggccatcatgggcattcacagcatcgtgaaacggcccgtgttt
gacgaaaacgatcaggtcgtgcccggccacatgatgtacctgtcgctgtccttcgatcac
cgcctggtggacggcgcggaggcggcccgtttctgcaaggaagtcatccgcctgctggaa
aacccggagactttgctgctcgaagccatctga

DBGET integrated database retrieval system