KEGG   Deinococcus peraridilitoris: Deipe_2801Help
Entry
Deipe_2801        CDS       T02381                                 

Definition
(GenBank) mannose-1-phosphate guanylyltransferase
  KO
K00971  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
dpd  Deinococcus peraridilitoris
Pathway
dpd00051  Fructose and mannose metabolism
dpd00520  Amino sugar and nucleotide sugar metabolism
dpd01100  Metabolic pathways
dpd01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dpd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Deipe_2801
   00520 Amino sugar and nucleotide sugar metabolism
    Deipe_2801
Enzymes [BR:dpd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     Deipe_2801
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 MannoseP_isomer
Motif
Other DBs
NCBI-ProteinID: AFZ68265
UniProt: L0A5G6
Position
complement(2813946..2815007)
Genome map
AA seq 353 aa AA seqDB search
MNQFVSVILAGGSGERFWPLSRKHKPKQFLSLDHTGSTLLQATAERLLAIHPNTDNLYVI
TSAEYRGLVLEQLPELPVENLIVEPFARDTAPAVLYATLCLQKRYDNPIIGFFPADHRVT
SDERFERCMLRAADAAERHGSLVVLGIEPNFPATGYGYIRRGESVPGRGVYHVSHFAEKP
DVETAQAYLDTGVYCWNSGMLVASMNTLLEEFRTHQNELLTVLSAAKNRLSTREAYASTE
KISFDYAILEKSKRVHVVPGDFDWDDLGDWNALERLLKNNHGAPSSGRHVGLDTEGVLLY
NTNSNELIVTIGLEDVTIVSDKEVTLVVRKERTQDIKKVVQQLKNTPGLERFA
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaattcgtatcggtcattttggcgggcggcagtggagagcggttctggccgctt
tcccgcaagcacaagcccaaacagtttttgtcactcgatcacacgggcagcacgctgctg
caggccaccgccgagcggctgctcgccattcaccccaacaccgacaacctgtatgtcatc
acgagcgccgagtaccgtgggctggtgctcgagcagcttcccgaattgccggtcgagaac
ctgatcgtcgaaccgtttgcccgtgatactgcgcctgcggtgctgtacgccacgctgtgc
ctgcaaaagcgctacgacaatccgatcatcggcttttttccggctgaccaccgggtcacc
agtgatgaacgcttcgagcgttgcatgctgcgcgccgccgacgctgccgagcgtcacggc
tcgctggtcgtgctgggcatcgaacccaattttccggccaccggctacggctacatccgg
cgcggcgaaagcgtaccgggccgtggcgtctaccacgtgtcgcactttgccgagaaaccc
gatgtggagacggctcaggcttaccttgacaccggtgtctactgctggaacagcggcatg
ctggttgccagcatgaacacgctgctcgaggaatttcgtacccatcagaacgagctgctg
accgtgctgagcgcagccaagaaccgcctgagcacccgcgaagcctacgccagcaccgag
aagatcagcttcgactacgccattctggaaaaatccaagcgtgtgcatgtcgtgcccggc
gacttcgactgggacgatctgggtgactggaacgccctggaacggctgctcaagaacaac
cacggtgcgcccagctcgggacgccatgtcggactcgacaccgagggcgtactgctgtac
aacaccaacagcaacgagctgattgtcaccatcggactcgaggacgtcaccatcgtcagc
gacaaggaagtcacgctggtcgttcgcaaagagcgcactcaggacattaaaaaagtggtt
cagcaactcaagaacacacccggactcgaacgcttcgcctga

DBGET integrated database retrieval system