KEGG   Deinococcus peraridilitoris: Deipe_2958Help
Entry
Deipe_2958        CDS       T02381                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
dpd  Deinococcus peraridilitoris
Pathway
dpd00900  Terpenoid backbone biosynthesis
dpd01100  Metabolic pathways
dpd01110  Biosynthesis of secondary metabolites
dpd01130  Biosynthesis of antibiotics
Module
dpd_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:dpd00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Deipe_2958
Enzymes [BR:dpd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Deipe_2958
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N TPR_12
Motif
Other DBs
NCBI-ProteinID: AFZ68413
UniProt: L0A3E0
Position
complement(2979684..2980529)
Genome map
AA seq 281 aa AA seqDB search
MILFAPAKVNFGLSVLSVRPDGYHELHSVMVPLSVGDELEIAPAGHLSLVVQGAQLPEGN
GNLVYRAARAYLDAAGVWEGARIVLKKLLPVASGLGGGSSDAASTLLGLARLYPSEVSRT
PGGLARLALSLGADVPFFLREGAAIAQGVGERLSPIRFQPVHLVLANPGVAVSAADAYRW
LDETHGFTPALDLPAVLAALHEEREVPWLNALQPAVIARHPEIARALAALSEVGLHSPLM
SGSGATCFALASSPEQAADAARRLSEANPAWWVRPARTLSE
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
gtgatcctcttcgcgcctgccaaggtaaacttcggcctcagcgtcctgtcggtccgcccg
gacgggtatcacgagttgcactccgtgatggtgcccctctcggtgggcgacgagctggag
attgctccggccggacacctgtcgctggtggtgcagggcgcgcagctacccgagggcaac
ggcaacctggtgtaccgcgccgcccgcgcgtaccttgacgccgccggagtgtgggaaggc
gcgcgtatcgtgctcaaaaagctgctgccggtcgcctccggtctgggcgggggatcgtcg
gacgcggcgagtaccctgctggggcttgcccggctgtatccgtcggaggtgtcgcggaca
ccgggcggtctggcgcggctggccctctctcttggcgccgacgtgccgtttttcttgcgt
gagggcgcggcaatcgcgcaaggtgtcggggaacggctctcccccattcggttccaaccg
gtgcaccttgtgctggccaatcccggggtggcggtcagcgccgccgacgcctaccgctgg
ctggacgaaacgcacggctttacgcccgcgctggacctgccagccgtcctcgcggccctg
cacgaggagcgtgaggtgccgtggctcaatgcgctgcagcctgccgtcatcgcgcgtcac
cccgaaatcgcgcgcgcgctcgcggccctgtcggaagtcgggctgcacagtccgctgatg
agcggctcgggggcgacctgcttcgcgctggccagttcacccgaacaggcggcagacgcg
gcccggcgtctgagcgaagcaaacccggcctggtgggtccgcccggcccgcacgctcagc
gagtaa

DBGET integrated database retrieval system