KEGG   Deinococcus peraridilitoris: Deipe_3309Help
Entry
Deipe_3309        CDS       T02381                                 

Definition
(GenBank) tRNA pseudouridine 55 synthase
  KO
K03177  tRNA pseudouridine55 synthase [EC:5.4.99.25]
Organism
dpd  Deinococcus peraridilitoris
Brite
KEGG Orthology (KO) [BR:dpd00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dpd03016]
    Deipe_3309
Enzymes [BR:dpd01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.25  tRNA pseudouridine55 synthase
     Deipe_3309
Transfer RNA biogenesis [BR:dpd03016]
 Eukaryotic Type
  tRNA modification factors
   Psudouridine synthases
    Deipe_3309
 Prokaryotic Type
    Deipe_3309
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TruB_N TruB_C_2 TruB_C
Motif
Other DBs
NCBI-ProteinID: AFZ68750
UniProt: L0A6T8
Position
complement(3326011..3326946)
Genome map
AA seq 311 aa AA seqDB search
MPVYAVDKPLKRTSHDVVSRARRLLGTRRVGHTGTLDPLASGVLVLCSESSTKLVQFMDS
DSKDYLAWISLGAATLTLDAEGPVTETAFATPPGVTEVEAVLRDFIGHQRQIPPQYSALQ
VGGQRAYAVARAGGALELPARSVVIHDLRLLGVYPSLAAVPPRFAPGEDNVWAPAESGRF
FPLPEALGEFPTLVVWARVGSGTYLRSLARDIGERLGMPAHLSGLARTRVGQFQLSGACM
LEDLPNAAGIDDLGALELSRLALDARTAKDLRDGKRPDTELQGRYAAVLQDELVAVVDAD
GHQLRVVRAWH
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtctacgccgtcgacaagcccctcaagcgcacctcgcacgatgtggtgagccgc
gcccgtcgtctgctgggaacgagacgcgtcgggcataccggcaccctcgatcccctggcc
agcggcgtattggtattgtgcagcgagtccagcaccaagctggtgcagttcatggacagt
gacagcaaagactacctcgcgtggatttcgctgggcgcagccacccttaccctcgacgcc
gaaggccccgtgaccgaaacggcattcgcgaccccgcccggcgtgaccgaggtcgaagcc
gtcctgcgtgatttcatcggccaccagcgacagattcccccgcaatacagcgcgctgcag
gtcggaggacagcgcgcatacgctgtcgcccgtgccgggggtgcgctcgaactgcccgcc
cgtagcgttgtcatccacgacctgcgcctcctgggcgtgtacccctcgctggctgccgtt
cctccccgcttcgcgcccggtgaagacaatgtgtgggccccggccgagagcgggcgtttc
tttccacttcccgaggcgctcggtgagtttcccacgctggtcgtgtgggcccgggtgggc
agtggcacctatctgcgctcgctcgcccgggacatcggcgagcggctcggaatgcccgcc
cacctgtcaggtctggcgcgcacccgtgtcgggcaattccagctgtcaggcgcctgcatg
ctggaggatttgccgaacgcggcgggcatcgacgacttaggtgccctggagctgtcccgc
ctggcgctcgacgcccgcacggccaaggacctgcgcgacggtaagcgaccggacacggaa
ctgcagggtcgttatgctgccgtacttcaagacgagctggtagccgtggtggacgccgac
ggtcaccagctgcgcgttgtccgcgcctggcactga

DBGET integrated database retrieval system