KEGG   Deinococcus peraridilitoris: Deipe_3745Help
Entry
Deipe_3745        CDS       T02381                                 

Definition
(GenBank) ATP-dependent phosphoenolpyruvate carboxykinase
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
dpd  Deinococcus peraridilitoris
Pathway
dpd00010  Glycolysis / Gluconeogenesis
dpd00020  Citrate cycle (TCA cycle)
dpd00620  Pyruvate metabolism
dpd01100  Metabolic pathways
dpd01110  Biosynthesis of secondary metabolites
dpd01120  Microbial metabolism in diverse environments
dpd01130  Biosynthesis of antibiotics
dpd01200  Carbon metabolism
Module
dpd_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dpd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Deipe_3745
   00020 Citrate cycle (TCA cycle)
    Deipe_3745
   00620 Pyruvate metabolism
    Deipe_3745
Enzymes [BR:dpd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     Deipe_3745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_33
Motif
Other DBs
NCBI-ProteinID: AFZ69171
UniProt: L0A5Q1
Position
complement(3800981..3802567)
Genome map
AA seq 528 aa AA seqDB search
MTTAVERDLSHLGIRGATIHFNLTVPQLYEAALRLGEGRIAQGGPLAVVTTPHTGRSPKD
RFVVEDEHTRESVWWGGFNTPISPEVFENLLTKMTRWAGGRELFVQDLFAGTDPQYRLPV
RMITEMAYHSLFVRNMFVRPSEEELSSHQAEFTVLNLPSFRADPAVDGTRSETFILVSFS
RKMILVGGTKYAGENKKGIFGVLNYLLPEQGVMPMHCSANKGKEGDVALFFGLSGTGKTT
LSADPSRVLIGDDEHGWTEHGVFNFEGGCYAKVINLSEKAEPAIFRTTHMFGSVLENVVL
DEQGRPDLHDGSLTENTRSAYPIDFIENSDPSGQGGHPKNIIFLTADAYGVLPPIARLTR
EQMMYQFVSGFTAKIPGTEQGVVEPQPTFSTCFGAPFMPRHPAEYAGLLARKVAESGARV
WLVNTGWTGGKYGEGQRMSIQHTRALINAALSGELDRVEFVTEPFFNLAIPTSVPGVPSE
VLNPRDTWADQNEYDRTARKLAAMFRENFKRFQDGVSPEVTACMPDHG
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgacaacagctgttgaacgcgacctttcgcacctgggcattcgcggtgccacgatccat
ttcaacctgaccgttccacagttgtacgaagcagctcttcgccttggtgaaggacgcatc
gcgcagggcggcccgttggccgtggtcacgactccccacaccggacgctcccccaaggac
cgcttcgtcgttgaggatgagcacaccagggaaagcgtctggtggggcggtttcaatacg
cctatttcgcctgaagtgttcgaaaacctgctgaccaagatgacccgctgggcagggggc
cgtgaactcttcgtgcaggacctctttgccggaaccgacccgcagtaccggctgcccgtt
cgcatgatcaccgaaatggcctaccattcgctgttcgtccgcaatatgttcgtgcgaccc
agcgaggaggagctgtcctcacaccaggccgaattcacggttctcaacctgccctccttc
agggctgatccggcggttgacggcacgcgcagcgaaacatttatcctggtcagcttttcg
cgcaagatgatcctggtgggcggaaccaaatacgccggtgaaaacaagaaaggcatcttc
ggcgttctcaactacctgctgcccgagcagggtgtgatgcccatgcactgctcggccaac
aaaggcaaagaaggtgacgtggcgctgtttttcgggttgtccggcaccggaaagaccacg
ctgagcgccgacccctcgcgcgtgctgatcggcgacgacgagcacggctggaccgaacac
ggcgtcttcaacttcgagggtggctgctacgccaaggtcatcaacctttccgaaaaagcc
gagcctgccatcttccgcacgacccacatgttcggcagcgtcctcgaaaatgtggtgctc
gatgagcagggacggccagacctccacgatggcagcttgaccgagaacacccgcagcgcc
tacccgatcgacttcatcgaaaacagcgatccgtcgggtcagggtgggcaccccaagaac
atcatcttcctgacagccgacgcctacggcgtgctgcctccgatcgctcgcctcacgcgt
gaacagatgatgtatcagttcgtcagcggcttcacggccaagattcccggtaccgagcag
ggagtcgtcgagcctcagccgaccttcagcacctgctttggcgcgccgttcatgccgcgt
catcctgctgagtatgcggggctgctcgcgcgcaaggtcgcggaatcgggcgcgagggtg
tggctggtgaacaccggctggaccggtgggaaatacggcgagggccagcgcatgagcatc
cagcacacgcgcgccctgatcaacgcagcgctttccggtgagctcgatcgggtggaattc
gtcaccgagcctttcttcaacctcgcgattcccacgagcgttcccggtgtgcccagcgag
gtgctcaatccccgggacacctgggccgaccagaatgagtacgaccggacggcgcgcaaa
ctcgccgccatgttccgggaaaacttcaaacgttttcaggacggagtttcgccggaagta
accgcctgcatgcccgatcacggctga

DBGET integrated database retrieval system