KEGG   Drosophila persimilis: 6588134Help
Entry
6588134           CDS       T01063                                 

Definition
(RefSeq) flavin reductase (NADPH)
  KO
K05901  biliverdin reductase / flavin reductase [EC:1.3.1.24 1.5.1.30]
Organism
dpe  Drosophila persimilis
Pathway
dpe00740  Riboflavin metabolism
dpe00860  Porphyrin and chlorophyll metabolism
dpe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpe00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    6588134
   00860 Porphyrin and chlorophyll metabolism
    6588134
Enzymes [BR:dpe01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.24  biliverdin reductase
     6588134
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.30  flavin reductase (NADPH)
     6588134
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_10 NmrA Epimerase 3Beta_HSD NAD_binding_2 GDP_Man_Dehyd Shikimate_DH adh_short
Motif
Other DBs
NCBI-GeneID: 6588134
NCBI-ProteinID: XP_002013745
FlyBase: FBgn0160822
UniProt: B4G565
Position
Unknown
AA seq 204 aa AA seqDB search
MQRIAVIGGTGMTGECAVDHAIEKGLTVRLLYRTEATVPERFKSKVQLVKGDATNYDDVK
RLIDGVDGVCVVLGTRNKLEATTELSRGTENLIKAMKEEKLTKFSIVMSSFLWRPLNEVP
AVFHRLNEEHKRMLDLTKASGLDWIAILPPHIADEPASGYTVVYDEAPGRLVSKYDLGKF
IVDSLDQPEHYGKVCGIGKSPKSA
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgcattgcagttattggtggcaccggcatgaccggagagtgtgccgtagaccac
gccatagagaaaggtctgacggtgcgcctactttatcgtacagaggccactgtgcccgaa
cgtttcaaatccaaagttcaactggtgaaaggcgatgccaccaattacgatgatgtaaag
cgcttgattgacggcgtggatggcgtctgtgttgttctgggcacccgtaacaaactggag
gccaccaccgaactatcacgtggcacggagaacctcattaaggcaatgaaggaggaaaag
ctcaccaagttctccattgtcatgtcttcgttcttgtggcgtccccttaacgaggtgccc
gctgtatttcaccgcctgaacgaggaacataagcgcatgctggatttgacaaaggcctcg
ggattggattggattgccattctgccaccgcacattgccgacgaaccggccagtgggtat
accgtggtttacgacgaggcaccaggacgtctagtttccaaatacgatctaggaaagttc
attgttgatagcctggaccagccggagcattatggaaaggtttgcggcattggcaaaagc
ccaaaaagtgcctaa

DBGET integrated database retrieval system