KEGG   Drosophila persimilis: 6589038Help
Entry
6589038           CDS       T01063                                 

Definition
(RefSeq) putative gustatory receptor 22d
  KO
K08471  gustatory receptor
Organism
dpe  Drosophila persimilis
Brite
KEGG Orthology (KO) [BR:dpe00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:dpe04030]
    6589038
G protein-coupled receptors [BR:dpe04030]
 Others
  Chemoreception
   Insect odorant and taste
    6589038
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_7
Motif
Other DBs
NCBI-GeneID: 6589038
NCBI-ProteinID: XP_002015350
FlyBase: FBgn0156071
UniProt: B4G7S5
Position
Unknown
AA seq 382 aa AA seqDB search
MFRPHRGCRHKLVYIILYSILYSSWALGIFPFTYVSKERKLRRSKWLLVYGIAFNATLVV
LMLRPHGGEGESMANDPKLDVFQRNFVLKQISLLLGIGGVITICAMYLRTFWRSRDLCRI
YNQLLHLEVTYFKDYSVECPTFNRYVIQKGLLVIGGVASTLVIHMGMPNESVSLVKLGSF
LLAIHFHLGVAFIYRFVWLINRELLDLANRLRVRLEGSSSRVRLLLTLYGRLLDLNTRLT
ACYDYQTAMMMAIFLGGNIIVSFYMIVFSVSLSKMSVFVMLIMFPLALINNFLDFWLSIA
VCDLAERTGRQTSMILKLFNDMEILDKEMERSFAEFALFCSHRRLRFHHCGLFYVNYEMG
FQMLVTSVLYLLFLVQFDYMNL
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgttccgaccacatcgaggctgtcgtcataagttggtttatattatcctctattcgatt
ctgtacagttcctgggctcttggaatatttccatttacgtatgtctcgaaggaaagaaaa
ttgcggcgttccaaatggctcctggtctatggtattgccttcaacgcaactctggttgtc
ctgatgctgcggcctcatgggggggaaggtgaatccatggcgaatgaccccaagctggac
gtgttccagcggaactttgtgttaaagcaaatcagcctgctcctggggattggcggcgta
atcacaatctgcgcgatgtatctgcgaaccttctggaggagcagagacttgtgcaggatc
tacaaccagctgctgcatttggaggtgacatactttaaagattattcagtggagtgccca
accttcaatcgatatgtgatccaaaagggattgctcgtcatcggaggcgtggcatccaca
ttggtcatccatatgggaatgcccaacgagtccgtttccctggtaaagctgggcagcttc
ctgctggccatccacttccacctgggtgtggcatttatctaccgttttgtgtggctcatc
aaccgtgaacttctggacctggccaatcgactaagggtcaggctggaaggaagctcctct
cgtgtccgcctcctcctcacactctacggtcgcctcctggacctcaacacacgactcacc
gcctgctatgactaccagactgccatgatgatggccatctttttgggcggcaacatcatc
gtctccttctacatgatcgtcttcagcgtcagcctcagcaagatgtccgtctttgtaatg
ttgatcatgtttcccctggcgctgatcaacaatttcttggacttttggttgagcattgca
gtgtgtgatttggcagagcggactggcaggcaaacctccatgatcctgaagctatttaat
gatatggagatattggacaaggagatggaacgaagtttcgctgaatttgctctattctgc
agccatcgccggctaaggttccatcactgtggactgttctacgtgaactatgagatgggt
tttcaaatgctcgtcacgagtgtcttgtacttgcttttcctggtgcaatttgattatatg
aacttgtaa

DBGET integrated database retrieval system