KEGG   Drosophila persimilis: 6591085Help
Entry
6591085           CDS       T01063                                 

Definition
(RefSeq) protein peanut
  KO
K16944  septin 7
Organism
dpe  Drosophila persimilis
Brite
KEGG Orthology (KO) [BR:dpe00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dpe04131]
    6591085
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:dpe04812]
    6591085
   04147 Exosome [BR:dpe04147]
    6591085
Membrane trafficking [BR:dpe04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Septins
    6591085
Cytoskeleton proteins [BR:dpe04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 2
     6591085
Exosome [BR:dpe04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   6591085
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Septin MMR_HSR1 RsgA_GTPase AIG1 AAA_22 Ras DUF2058 FtsK_SpoIIIE AAA_16 Roc AAA_29 FeoB_N ABC_tran
Motif
Other DBs
NCBI-GeneID: 6591085
NCBI-ProteinID: XP_002015705
FlyBase: FBgn0148820
UniProt: B4GDB9
Position
Unknown
AA seq 534 aa AA seqDB search
MNSPRSNALNGGGSVGGGGAISALPSTLAQLALRDKQAASVTSNGSSESSVGRPAVQPPS
VPSIVASKLGESTPSSAGAPSNGDSNKLTHDLQEKEVQKPAKPPLPVRQKPMEIAGYVGF
ANLPNQVYRKAVKRGFEFTLMVVGASGLGKSTLINSMFLSDIYNAEQYPGPSLRKKKTVA
VEATKVMLKENGVNLTLTVVDTPGFGDAVDNSNCWVPILEYVDSKYEEYLTAESRVYRKT
ISDNRVHCCLYFIAPSGHGLLPLDIACMQSLSDKVNLVPVIAKADTMTPDEVHLFKKQIL
NEIAQHKIKIYDFPATIEDAAEESKTTQNLRSRVPFAVVGANTIIEQDGKKVRGRRYPWG
LVEVENLTHCDFIALRNMVIRTHLQDLKDVTNNVHYENYRCRKLSELGLVDGKARLSNKN
PLTQMEEEKREHEQKMKKMEAEMEQVFDMKVKEKMQKLKDSELELARRHEERKKALELQI
RELDEKRREFEREKKEWEDINHVTLEEMKRRSLGANSSTDNVDGKKEKKKKGLF
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgaatagtcctcgctcaaacgcgctcaatggcggcggcagcgtcggcggcggcggggcc
atctctgccctgcccagcaccctggcacaattggcgctgcgcgacaagcaggctgcctcc
gttaccagcaatggcagcagtgaatcctccgtcggtcggccggcagtgcagcccccgagt
gtgccatcgatagtcgccagcaagctgggcgagtccacaccctcatcggctggagcgccc
tccaatggtgattccaacaaactgacccacgatctgcaggagaaggaggtccagaagcca
gccaagccgccgctgccagtgcgccagaagcccatggagatcgccggctacgtgggcttt
gccaatcttcccaaccaggtgtaccgcaaggcggtgaagcgcggctttgaattcaccctg
atggttgtgggcgccagtggattgggcaagtcgacgctcatcaactccatgtttctgtcc
gacatctacaatgccgagcagtatccggggccctcgctgcgcaagaagaaaacggtggcc
gtggaggccaccaaagtgatgctcaaggagaacggcgtcaacctgacgctgaccgtagtg
gacacacccgggttcggcgatgccgtggacaacagcaactgctgggtgcccattctcgag
tacgtggacagcaagtacgaggagtacctgacggccgagtcgcgggtgtatcgcaagacc
atttccgacaaccgggtgcactgctgcctctacttcatagcgccatcgggccacggcctc
ctgccactggacattgcctgcatgcagagcctgtcggacaaggttaacctggtgccggtc
attgccaaggccgacaccatgacgccggacgaggtgcatctgttcaagaagcagatactc
aacgagattgctcagcataagattaagatctacgactttcccgccacgatcgaggatgcg
gcagaggagtcgaagaccacgcagaacctgcgtagccgtgtgccatttgccgttgtcgga
gccaacaccattatcgagcaggacgggaagaaggtgcgcggtcggcggtacccctggggc
ctggtggaggtggaaaatcttacacactgcgactttattgccctgaggaacatggtgatc
cggacgcatctgcaggacctcaaggacgtgacgaacaacgtgcactacgagaactatcgc
tgccgcaagctgtccgagctgggcctggtcgatggcaaggcgcggctctcgaacaagaac
cccctgacccagatggaggaggagaagcgcgagcacgagcagaagatgaagaagatggag
gccgaaatggagcaggtgttcgacatgaaggtcaaggagaagatgcagaagctcaaggac
tccgaactggagctggcccgccgccacgaggagcgcaagaaggccctcgagctgcagatc
agggagctggacgagaagcggcgtgagttcgagcgcgagaagaaggagtgggaggacatc
aaccatgtgacgctcgaagagatgaagcggcgcagcctgggcgccaacagcagcaccgac
aacgtggacggtaagaaggagaagaaaaagaagggtctgttctaa

DBGET integrated database retrieval system